KEGG   Mus musculus (mouse): 66679Help
Entry
66679             CDS       T01002                                 

Gene name
Rae1, 3230401I12Rik, 41, D2Ertd342e, MNRP, MNRP41
Definition
RAE1 RNA export 1 homolog (S. pombe)
Orthology
K14298  
mRNA export factor
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:mmu03013]
Human Diseases; Infectious diseases; Influenza A [PATH:mmu05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 H3; 2 95.66 cM
AA seq 368 aa AA seqDB search
MSLFGSTSGFGTGGTSMFGSTTTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPIAACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtttggatcaacctctggatttgggactggtgggaccagcatgtttgggagc
acaaccacagataaccacaatccaatgaaggatatcgaagtgacatcttctcctgatgac
agcatcggttgtctgtctttcagcccgccaactttaccaggcaacttccttattgcagga
tcatgggcgaatgatgttcgctgctgggaagtgcaggacagtgggcaaaccattccaaag
gcccagcagatgcacacggggccagtgcttgacgtctgctggagtgatgatgggagcaaa
gtattcacagcatcgtgtgacaagacagccaagatgtgggacctgaacagcaaccaggcc
attcagatagcacagcatgatgctcctgttaagaccatacattggatcaaagccccaaac
tacagctgtgtgatgaccgggagctgggataagactctgaagttctgggatacgcggtcc
tcaaatcctatgatggtcttgcaactccctgaacgctgttactgtgcagatgtgatatac
ccgatggctgtggtagccactgcagagaggggcctgattgtctatcagctggagaaccag
ccctctgagttcaggagaatcgagtctcccctgaagcaccagcatcggtgtgtggctatt
tttaaagacaaacagaacaagccgactgggtttgctctgggcagcattgaggggagagtt
gccattcactacatcaaccctccaaatccggccaaagataacttcaccttcaaatgccat
cgatccaacggtaccaacacttcggctcctcaagacatctatgcagtgaatgggattgcc
ttccatcctgtccatggtacccttgccactgtgggctccgatggtaggttcagcttctgg
gacaaagatgccaggaccaaactaaagacttcggaacagttagatcagcccatcgcagct
tgctgcttcaatcacaatggaaacatatttgcctatgcttccagctacgactggtccaag
ggacatgagttttataatccccaaaagaaaaattacattttcttgcgtaatgcagctgaa
gagctaaagccaaggaataagaaatag

DBGET integrated database retrieval system