KEGG   Mus musculus (mouse): 66724Help
Entry
66724             CDS       T01002                                 

Gene name
Tab3, 4921526G09Rik, Map3k7ip3, mKIAA4135
Definition
(RefSeq) TGF-beta activated kinase 1/MAP3K7 binding protein 3
  KO
K12793  
TAK1-binding protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
NF-kappa B signaling pathway
NOD-like receptor signaling pathway
TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    66724 (Tab3)
   04668 TNF signaling pathway
    66724 (Tab3)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    66724 (Tab3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
X; X C1
AA seq 716 aa AA seqDB search
MAQNSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHS
PEDNRMNRNRLLHINLGIHSPSSYHPGDGAHLNGGRTLVHSSSDGHIDPQHTAGKQLICL
VQEPHSAPAVVAATPNYNPFFMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPP
PPSYMHIPRYSTNPITVTVSQNLPSGQTVPRALQILPQIPSNLYGSPGSIFIRQTSQSSS
GRQTPQNAPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSVYHSPPPSQC
PSPFSSPQHQVQPPQLGHPSSHVFMPPSPSTTPPHLYQQGPPSYQKPGSHSVAYLPYTAS
SLPKGSMKKIEITVEPSQRPGTAITRSPSPISNQPSPRNQHSLYTATTPPSSSPSRGISS
QPKPPFSVNPVYITYTQPTGPSCAPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEER
SAAPEPIQPISVIPGSGGEKGNHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLE
KEELERLKAEVNSMEHDLMQRRLRRVSCTTAIPTPEEMTRLRSTNRQLQINVDCTLKEVD
LLQSRGNFDPKAINNFYDHIEPGPVVPPKPSKKDSSDSCAIERKARRISVTSKAPVDIHD
AQAAAADEHLSICKQSARTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaacagtccacagcttgatattcaggttctccatgatcttcgacaacgtttt
cctgaaattccagagggtgtggtatcccagtgcatgttacagaataacaacaatctagaa
gcctgttgtcgagccctttcccaggagagcagcaaatacttgtatatggaataccatagt
ccagaagacaatagaatgaatagaaatcgccttttgcatattaatttgggtattcattct
cctagtagctaccacccaggagatggagctcaccttaatggtggtcggacactggtacat
agctcaagtgatggacatattgatcctcagcatacagcaggcaaacagctgatatgttta
gttcaggaaccacactcagctccagctgttgtggctgctactcccaactataatccgttt
tttatgaatgagcagaacagaagtgcagctaccccgccttcacagccacctcagcagcca
tcttccatgcaaacaggaatgaatccatctgctatgcaaggtccttcaccaccaccacca
cctccgtcctacatgcacatacctcggtatagtacaaatccaattactgttacagtgtcc
caaaaccttccttctggacagactgtgccaagagctttacagattcttccacaaattcca
agcaatctctatggatctcctgggtctatttttattagacagacatctcagagttcatca
ggaagacagactcctcagaatgctccatggcagtcctcaccacaaggcccagtgcctcat
tacagccagcgtcctttacctgtttatccacatcaacagaactatcaaccttctcagtat
tctcccaaacaacagcagattcctcagtcagtttaccattcaccacctccttctcagtgt
ccttccccctttagctctccacagcatcaagtacaaccaccccagctgggtcacccaagc
tctcatgtgtttatgccacccagtccttcaactactccaccccacctatatcaacaagga
cctcctagttatcagaaaccaggaagtcattcggtagcctatctcccttacacagcatct
agcttacccaaaggttccatgaagaagatagaaattacagttgaaccttctcaaagacct
gggacagcaataactagaagtccgtcacctatcagtaatcaaccatctccaaggaaccag
cattcactgtacacagccaccacaccaccttcaagttccccttcaagagggatctctagt
caaccaaaacctccatttagtgttaatcctgtgtatattacgtatacacagccaactgga
ccttcatgtgctccatcaccatctcctcgggtgataccaaatccaactacagtttttaaa
attactgtaggccgagcaacaactgaaaaccttttaaatttagtggaccaagaagaacgc
tctgcagcaccagaacctattcagcccatttcagtgataccaggctctgggggagaaaag
ggaaaccacaagtatcaaaggagctctagttctggatcagatgactatgcctatacccaa
gccttgctgttacatcagcgagcaagaatggagaggttagcaaagcaattgaaacttgaa
aaagaggagctagagcggttgaaagctgaagttaacagtatggagcatgacctgatgcag
agacggcttagaagagtcagctgcaccactgcaattcccacgcctgaggaaatgacaaga
ttgagaagcacgaacagacaactccagataaatgttgactgtacactgaaagaagttgac
ctccttcaatctagaggaaactttgatccaaaagccatcaataatttttatgaccacata
gaacctggcccagttgtaccaccgaagccatctaaaaaagactcctcagactcctgtgca
attgagagaaaagcccgaagaattagtgtgacttccaaagcgccagtagatatccatgac
gcccaggcagcagctgcagatgaacatttaagtatctgcaaacagagtgctcggacacaa
ccccgagatgaggattatgaaggggctccgtggaattgtgacagctgtacctttctcaac
caccctgcactgaatcgctgtgagcagtgtgagatgccacggtacacttga

DBGET integrated database retrieval system