KEGG   Mus musculus (mouse): 66853Help
Entry
66853             CDS       T01002                                 

Gene name
Pnpla2, 0610039C21Rik, 1110001C14Rik, Atgl, TTS-2.2
Definition
(RefSeq) patatin-like phospholipase domain containing 2 (EC:3.1.1.3)
  KO
K16816  
patatin-like phospholipase domain-containing protein 2 [EC:3.1.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerolipid metabolism
Metabolic pathways
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    66853 (Pnpla2)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    66853 (Pnpla2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     66853 (Pnpla2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 F5
AA seq 486 aa AA seqDB search
MFPRETKWNISFAGCGFLGVYHIGVASCLREHAPFLVANATHIYGASAGALTATALVTGA
CLGEAGANIIEVSKEARKRFLGPLHPSFNLVKTIRGCLLKTLPADCHERANGRLGISLTR
VSDGENVIISHFSSKDELIQANVCSTFIPVYCGLIPPTLQGVRYVDGGISDNLPLYELKN
TITVSPFSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPMVLREMCKQ
GYRDGLRFLRRNGLLNQPNPLLALPPVVPQEEDAEEAAVVEERAGEEDQLQPYRKDRILE
HLPARLNEALLEACVEPKDLMTTLSNMLPVRLATAMMVPYTLPLESAVSFTIRLLEWLPD
VPEDIRWMKEQTGSICQYLVMRAKRKLGDHLPSRLSEQVELRRAQSLPSVPLSCATYSEA
LPNWVRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPDALRMRAPASPTAADPATPQDP
PGLPPC
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgttcccgagggagaccaagtggaacatctcattcgctggctgcggcttcctcggggtc
taccacattggcgtggcctcctgcctccgtgagcacgcgcccttcctggtggccaacgcc
actcacatctacggagcctcggcaggggcgctcaccgccacagcgctggtcactggggcc
tgcctgggtgaagcaggtgccaacattattgaggtgtccaaggaggcccggaagcggttc
ctgggtcctctgcatccctccttcaacctggtgaagaccatccgtggctgtctactaaag
accctgcctgctgattgccatgagcgcgccaatggacgcctgggcatctccctgactcgt
gtttcagacggagagaacgtcatcatatcccactttagctccaaggatgagctcatccag
gccaatgtctgcagcacatttatcccggtgtactgtggcctcattcctcctaccctccaa
ggggtgcgctatgtggatggcggcatttcagacaacttgccactttatgagctgaagaat
accatcacagtgtccccattctcaggcgagagtgacatctgccctcaggacagctccacc
aacatccacgagcttcgcgtcaccaacaccagcatccagttcaaccttcgcaatctctac
cgcctctcgaaggctctcttcccgccagagcccatggtcctccgagagatgtgcaaacag
ggctacagagatggacttcgattccttaggaggaatggcctactgaaccaacccaaccct
ttgctggcactgcccccagttgtcccccaggaagaggatgcagaggaagctgctgtggtg
gaggagagggctggagaggaggatcaattgcagccttatagaaaagatcgaattctagag
cacctgcctgccagactcaatgaggccctgctggaggcctgtgtggaaccaaaggacctg
atgaccaccctttccaacatgctaccagtgcgcctggcaacggccatgatggtgccctat
actctgccgctggagagtgcagtgtccttcaccatccgcttgttggagtggctgcctgat
gtccctgaagatatccggtggatgaaagagcagacgggtagcatctgccagtatctggtg
atgagggccaagaggaaattgggtgaccatctgccttccagactgtctgagcaggtggaa
ctgcgacgtgcccagtctctgccctctgtgccactgtcttgcgccacctacagtgaggcc
ctacccaactgggtacgaaacaacctctcactgggggacgcgctggccaagtgggaagaa
tgccagcgtcagctactgctgggtctcttctgcaccaatgtggccttcccgccggatgcc
ttgcgcatgcgcgcacctgccagccccactgccgcagatcctgccaccccacaggatcca
cctggcctcccgccttgctga

DBGET integrated database retrieval system