KEGG   Mus musculus (mouse): 66899Help
Entry
66899             CDS       T01002                                 

Gene name
Fip1l1, 1300019H17Rik, Rje
Definition
(RefSeq) FIP1 like 1 (S. cerevisiae)
  KO
K14405  
pre-mRNA 3'-end-processing factor FIP1
Organism
mmu  Mus musculus (mouse)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    66899 (Fip1l1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     66899 (Fip1l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5; 5 D
AA seq 581 aa AA seqDB search
MSAGEVERLVELSGGTGGDEEEEWLYGGPWDVHVHSDLAKDLDENEVERPEEENASANPP
SGIEEEAAENGVAKPKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNLN
IKAGGRVYGNTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGFN
EDTWKAYCEKQKRIRMGLEVIPVTSTTNKITVQQGRTGNSEKEAALPSTKAEFTSPPSLF
KTGLPPSRNSTSSQSQTSTASRKASSSVGKWQDRYGRAESPDLRRLPGAIDVIGQTITIS
RVEGRRRANENSNIQVLSDRSATEVDNNFSKPPPFFPPGAPPTHLPPPPFLPPPPTVSTA
PPLIPPPGIPITVPPPGFPPPPGAPPPSLIPTIESGHSSGYDSRSARAFPYGNVAFPHLT
SSAPSWPSLVDTTKQWDYYARREKDRDRDRERDRDRERERDRDRERERTRERERERDHSP
TPSVFNSDEERYRYREYAERGYERHRASREKEERHRERRHREKEETRHKSSRSNSRRRHE
SEEGDSHRRHKHKKSKRSKEGKEAGSEPVPEQESTEAAPAE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccggcgaggtggagcgcctggtggagctgagcggcgggaccggaggggatgag
gaggaagagtggctgtatggcggcccgtgggacgtgcatgtgcacagtgacttggcaaag
gatctagatgagaatgaagttgaaaggccagaagaagaaaatgccagtgctaatcctcca
tctggaattgaagaagaagctgctgaaaatggcgtggcaaaaccgaaagtgacagagact
gaagacgacagtgatagtgacagtgacgatgatgaagatgatgttcacgtcactatagga
gacatcaaaacaggagcaccacagtatgggagttatggaacagcaccagtaaatcttaat
atcaaggcagggggaagagtttatggaaatacaggaaccaaagtcaaaggagtggacctc
gatgcacctggcagcattaatggagttccactcttggaagtagatctggattcttttgaa
gataaaccatggcggaaacctggtgctgatctttctgattattttaactatggctttaat
gaagatacttggaaagcttactgtgaaaaacaaaagaggatacgaatgggactggaagtt
atacctgttacttcaaccacaaacaagattacggtacagcaagggagaactggaaattca
gagaaagaagcagcacttccatctacaaaagctgagtttacttctccgccatcattgttc
aagactggtctgccaccaagcagaaacagcacctcttctcagtctcagacaagtactgcc
tccagaaaagccagttcaagcgttgggaagtggcaggatcgatatgggagggccgagtca
cctgatctaaggagattacctggagcaattgatgtcattggtcaaacaataaccatcagc
cgagtggaaggaagacggcgtgcaaatgagaacagcaatatacaggtcctttctgacaga
tctgccactgaagtagacaacaatttcagcaaaccacctccatttttccctccaggggct
cctcctactcaccttcctcctcctccatttctcccaccacctccaactgtcagcaccgcc
ccacctctcattccaccaccaggtattccaataactgtaccacctccaggtttcccccct
ccaccaggcgccccacctccatctcttataccaacaatagaaagtggccattcctccggg
tatgacagccgttctgcacgagcgtttccctatggcaatgtcgcctttccccaccttacc
agttctgctccctcatggccgagccttgtggacaccaccaagcagtgggactattatgca
aggagagaaaaagaccgagaccgagaccgggagagagaccgagacagagagcgagagcgg
gaccgggacagagaaagggagcgcacccgggagcgggagcgagagcgcgaccacagcccc
accccaagtgttttcaacagtgacgaagagcgatacagatacagggagtatgcagagaga
ggctatgagcgccatagagctagtcgggagaaagaagagcggcacagagaacgacgtcac
agagagaaggaggaaacaagacacaagtcctctcgcagtaatagtagacgtcgccatgaa
agtgaagaaggggacagtcacagaagacacaagcacaaaaagtctaaaagaagcaaagaa
ggaaaagaggctggcagcgagccggtcccagaacaggagagcaccgaagccgcccctgcc
gagtag

DBGET integrated database retrieval system