KEGG   Mus musculus (mouse): 66973Help
Entry
66973             CDS       T01002                                 

Gene name
Mrps18b, 2400002C15Rik
Definition
mitochondrial ribosomal protein S18B
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
mmu  Mus musculus (mouse)
Pathway
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:mmu05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17; 17 B3
AA seq 254 aa AA seqDB search
MAAPLRHTLLKLVPTLLRSSYVAQVPLQTLCTRGPPEEDAPSSLPVSPYESEPWKYLDSE
EYHNRYGSRPVWADYRRNHKGGVPPQRTRKTCIRNNKVAGNPCPICRDHKLHVDFRNVKL
LEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARECGLLSYYVPQVEPRDADFGTVHG
AVSVTPPAPTLLSGEPWYPWYSWQQPPERELSRLRRLYQGNLLEESGPPPESMPEMPTTP
PAESSIEQPGSQSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccccttgcggcacacgcttctaaagctggttcctacactcttacgaagttcc
tatgtagctcaggttcccctccagactctttgcaccagaggccctcctgaagaagatgct
ccatcctcgcttcccgtttccccatatgagagcgagccttggaagtacctggattcagaa
gaataccacaaccgctatggctctcgccctgtttgggctgactaccgccgcaaccacaaa
ggtggtgtgccaccacagcggacccgaaagacatgtattcgtaacaataaagttgctggg
aatccttgcccaatctgccgggatcacaagttgcatgttgactttaggaatgtgaagctc
ttggaacagtttgtctgtgcacacacgggtatcatctttcacgccccatacacaggggtc
tgtatgaagcagcacaagaagctgacccaggccatccagaaagccagggagtgtggtctt
ctcagttactacgtcccccaggttgagccccgggatgctgactttggtactgtgcatgga
gctgtcagtgtgactccaccagcccccacactgttgtcaggtgaaccttggtacccatgg
tacagctggcaacagccaccagagagagagctgtctcgccttcgccgactctatcaagga
aatctcctagaagaaagtggcccgccacctgagtcgatgccagagatgcccactacacca
ccagcagaatcctccattgagcagccaggctcccagagtgcttag

DBGET integrated database retrieval system