KEGG   Mus musculus (mouse): 66973Help
Entry
66973             CDS       T01002                                 

Gene name
Mrps18b, 2400002C15Rik
Definition
(RefSeq) mitochondrial ribosomal protein S18B
  KO
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
mmu  Mus musculus (mouse)
Pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    66973 (Mrps18b)
Ribosome [BR:mmu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    66973 (Mrps18b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17; 17 B1
AA seq 162 aa AA seqDB search
MAAPLRHTLLKLVPTLLRSSYVAQNVKLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAI
QKARECGLLSYYVPQVEPRDADFGTVHGAVSVTPPAPTLLSGEPWYPWYSWQQPPERELS
RLRRLYQGNLLEESGPPPESMPEMPTTPPAESSIEQPGSQSA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccccttgcggcacacgcttctaaagctggttcctacactcttacgaagttcc
tatgtagctcagaatgtgaagctcttggaacagtttgtctgtgcacacacgggtatcatc
tttcacgccccatacacaggggtctgtatgaagcagcacaagaagctgacccaggccatc
cagaaagccagggagtgtggtcttctcagttactacgtcccccaggttgagccccgggat
gctgactttggtactgtgcatggagctgtcagtgtgactccaccagcccccacactgttg
tcaggtgaaccttggtacccatggtacagctggcaacagccaccagagagagagctgtct
cgccttcgccgactctatcaaggaaatctcctagaagaaagtggcccgccacctgagtcg
atgccagagatgcccactacaccaccagcagaatcctccattgagcagccaggctcccag
agtgcttag

DBGET integrated database retrieval system