KEGG   Mus musculus (mouse): 66988Help
Entry
66988             CDS       T01002                                 

Gene name
Lap3, 2410015L10Rik, AA410100, LAP-3, Lap, Lapep, Pep-7, Pep-S, Pep7, Peps
Definition
(RefSeq) leucine aminopeptidase 3 (EC:3.4.11.5 3.4.11.1)
  KO
K11142  
cytosol aminopeptidase [EC:3.4.11.1 3.4.11.5]
Organism
mmu  Mus musculus (mouse)
Pathway
Arginine and proline metabolism
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    66988 (Lap3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    66988 (Lap3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     66988 (Lap3)
    3.4.11.5  prolyl aminopeptidase
     66988 (Lap3)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M17: leucyl aminopeptidase family
   66988 (Lap3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 B3; 5 24.98 cM
AA seq 519 aa AA seqDB search
MYLLPLPAAARVALRRLGVRGLWDRGLSTADMTKGLVLGIYAKDKDDDLPQFTSAGESFN
KLVSGKLREMLNISGPPLKAGKTRTFYGLHQDFPSVVVVGLGKRSAGVDDQENWHEGKEN
IRAAVAAGCRQVQDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGS
GDLEAWEKGVLFASGQNLARHLMESPANEMTPTRFAEIIEKNLKSASSKTKVHIRPKSWI
EEQEMGSFLSVAKGSEEPPVFLEIHYMGSPNATEAPLVFVGKGITFDSGGISIKASANMD
LMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRARNGKTIQV
DNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDVALGSGATGVFTNSSWLWNKLFE
ASVETGDRVWRMPLFEHYTRQVIDCQLADVNNLGKYRSAGACTAAAFLREFVTHTKWAHL
DIAGVMTNKDEIPYLRKGMSGRPTRTLIEFLLRFSKDSS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtacttgctgccccttccggctgccgcgcgagtcgcgctccgccgcctgggagtgaga
ggtctctgggatcggggtctgtccaccgcagacatgacgaagggccttgttttaggaatt
tatgccaaagacaaagatgatgacctgccacaatttacaagtgcgggagagagttttaat
aagttggtgtctggaaagctgagggaaatgttgaacatatctggacctcctctcaaagca
ggcaaaaccagaaccttctatggtctgcatcaggacttccccagcgtggtggtggtcggc
cttggcaagcgatcggctggagttgatgaccaggaaaactggcacgaaggcaaagaaaac
atcagagctgctgttgcagcgggatgcaggcaggtccaagacctggagctgccgtcggtg
gaggtggatccctgtggagatgcgcaagctgctgcagaaggagctgtgcttggtctctat
gagtacgatgacctgaagcagaagaagaaggtggctgtgtcggcgaagctccacggaagc
ggtgatctcgaggcctgggagaaaggggtcctctttgcttctggacagaacttggcccgt
catctgatggagtctccagccaatgagatgacaccaaccagattcgctgaaatcattgaa
aaaaacctcaaaagtgccagtagtaaaaccaaggtccatatcagacccaagtcctggata
gaggaacaagaaatgggttcgttcctaagtgtagccaaggggtctgaagaaccaccagtc
ttcttggaaatccactacatgggcagccccaatgcaaccgaggcacccctggtgtttgtg
gggaagggcattacctttgacagtggaggtatctccatcaaggcttctgcaaacatggac
ctcatgagggctgatatgggaggagcagcaacaatatgctcggccattgtgtctgcggca
aagctcaacttgcccattaacatcattggtttggcccctctttgtgaaaatatgcctagc
ggcaaggccaacaagccaggggatgtcgtcagagccaggaatgggaagaccatccaggtt
gataacactgacgccgaggggaggctcatcctggccgatgcactctgttatgcacacacc
tttaatcccaaggtcatcatcaatgctgccaccttaacaggtgccatggatgtagccctg
gggtcaggtgccactggagtctttaccaattcgtcctggctgtggaacaaactatttgag
gccagcgtagaaactggggaccgagtctggaggatgcccctctttgagcattatacaaga
caagtcatagattgccagcttgctgatgtcaacaatcttggaaaatacagatctgcaggt
gcgtgtacagctgccgcattcctgcgagagtttgtgacacatacgaagtgggcacactta
gacatagcaggagtgatgaccaacaaagatgagattccctacctgcggaaggggatgagt
gggcggcccacgaggactctgattgagttcttacttcgattcagtaaagacagttcttag

DBGET integrated database retrieval system