KEGG   Mus musculus (mouse): 67054Help
Entry
67054             CDS       T01002                                 

Gene name
Paics, 2610511I09Rik, ADE2H1, AIRC, PAIS
Definition
phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoribosylaminoimidazole, succinocarboxamide synthetase (EC:6.3.2.6 4.1.1.21)
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
mmu  Mus musculus (mouse)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    67054 (Paics)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     67054 (Paics)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     67054 (Paics)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5; 5 E1
AA seq 425 aa AA seqDB search
MATAVVVNIGKKLYEGKTKEVYELLDTPGRVLLQSKDQITAGNAARKNHLEGKAAISNKI
TSCIFQLLQEAGIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVQEGYK
FYPPKVEMFFKDDANNDPQWSEEQLIAAKFCFAGLVIGQTEVDIMSHATQAIFEILEKSW
LPQDCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPE
GLQMVKKNFEWVADRVELLLKSDSQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVT
SAHKGPDETLRIKAEYEGDGIPTVFVSVAGRSNGLGPVLSGNTAYPVISCPPITPDWGAQ
DVWSSLRLPSGIGCSTILSPEGSAQFAAQIFGLNNHLVWAKLRASILNTWISLKQADKKV
RQCNL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagccgtagtagtgaacatcgggaagaagctctacgagggtaaaacaaaagaa
gtctatgagttgttagacaccccaggcagagtcctcctgcagtccaaggaccagatcaca
gcagggaatgcagctaggaagaaccacctggaaggcaaagccgccatctccaacaagatc
accagctgcatatttcagttgttacaggaagctggtataaaaactgctttcaccaagaaa
tgcggggagactgctttcattgcaccccagtgtgaaatgatccccattgagtgggtgtgc
cgaagaatagcaactgggtctttcctcaaaaggaaccctggggtacaggaggggtacaag
ttctatccacccaaagtggagatgttcttcaaggacgatgccaataatgatccacagtgg
tctgaggagcaactcattgctgcaaaattctgttttgctggccttgttatagggcagact
gaagtggacatcatgagtcatgccacacaagctatttttgaaattctggagaaatcctgg
ctgccccaggactgtacgctggttgatatgaagattgaatttggtgttgatgtaaccacc
aaagagattgttcttgctgatgtcattgataatgattcctggagactatggccatcggga
gatcggagccagcagaaggacaaacagtcttaccgtgatctcaaagaagtaactccagaa
ggactccagatggtaaagaaaaactttgagtgggttgcagaccgagtggagttgcttctc
aagtcagacagtcagtgcagggtggtagtgctgatgggctccacctctgaccttggtcac
tgtgagaaaattaagaaggcttgtggaaattttgggattccatgtgaacttagagtaaca
tctgcgcataaaggaccagatgagactttgaggattaaagcagaatatgaaggggatggc
atacctactgtatttgtctctgtggcgggcagaagcaatggtctaggcccagtgctgtct
ggcaatactgcatatccggttatcagctgtcccccgatcacaccagactggggcgctcag
gatgtgtggtcatctcttcgactgcccagtggtattggctgttcaactatactttctcca
gaaggatcagctcagtttgctgctcagatatttgggttaaacaatcatttggtgtgggcc
aaacttcgagcgagcatattaaacacgtggatatccttaaagcaggctgataagaaggtc
agacaatgcaatttgtaa

DBGET integrated database retrieval system