KEGG   Mus musculus (mouse): 67071Help
Entry
67071             CDS       T01002                                 

Gene name
Rps6ka6, 2610524K04Rik, RSK4, S6K-alpha-6
Definition
(RefSeq) ribosomal protein S6 kinase polypeptide 6 (EC:2.7.11.1)
  KO
K04373  
p90 ribosomal S6 kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Oocyte meiosis
mTOR signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Progesterone-mediated oocyte maturation
Insulin resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    67071 (Rps6ka6)
   04150 mTOR signaling pathway
    67071 (Rps6ka6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    67071 (Rps6ka6)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    67071 (Rps6ka6)
  Nervous system
   04720 Long-term potentiation
    67071 (Rps6ka6)
   04722 Neurotrophin signaling pathway
    67071 (Rps6ka6)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    67071 (Rps6ka6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     67071 (Rps6ka6)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   67071 (Rps6ka6)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     67071 (Rps6ka6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X; X E1
AA seq 860 aa AA seqDB search
MLNFRRTRHTPSGHRSNSNLNLFCCLPFFGCRRRSKSRQRAGTPVVPLLRYPRLARSAVT
QRETWSFEDDQEPAQQTGCMLVLGPGSFFSRAPEAAMLPFAPVEDPWDQEDMEVFGSTSS
SEPQVVFTMKNAATVMREHERKEVNDLKMVDEPMEEGEPVSCRREELVKEIPITQHVKEG
YEKADPAQFDLLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLRKASLKVRDRVRTKMER
DILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLAELAL
ALDHLHRLGIVYRDLKPENILLDEIGHIKLTDFGLSKESVDQEKKAYSFCGTVEYMAPEV
VNRRGHSQSADWWSYGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSAEAQSLL
RMLFKRNPANRLGSEGVEEVKRHAFFASIDWNKLYKREVQPPFRPASGKPDDTFCFDPEF
TAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPVTSSNVLPIVQINGNAAQFSE
AYELKEDIGIGSYSVCKRCIHSASNVEFAVKIIDKNKRDPSEEIEILMRYGQHPNIISLK
EVFDDGKYVYLVTDLMKGGELLDRILKKKCFSEQEASNVLYVITKTVECLHSQGVVHRDL
KPSNILYMDESAHPDSIKICDFGFAKQLRGENGLLLTPCYTANFVAPEVLTQQGYDAACD
IWSLGVLLYTMLAGYTPFSNGPNDTPEEILLRIGNGRFSLSGGIWDNISRGAKDLLSHML
HMDPHQRYTAEQVLKHPWITQREQLPRHQPNSDEPPQEAVAAPYSVLARNPNRHHPILEP
VTASRLAQRRNMKKRTSTGL
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgctgaattttagaaggacacgccacacgccatctggccacaggtccaactctaacttg
aacctgttctgttgtcttccattttttggatgtcgtcggcgatccaagagtcggcagcgg
gcggggacccccgtggtccctcttttgaggtacccgcggctggcgaggtcggcagtcacc
cagcgcgagacctggtccttcgaagacgaccaggagcccgctcagcagacgggatgcatg
ctggtgctggggccaggcagcttcttctcgagagcccctgaagcggcgatgctaccgttc
gcccctgtggaggatccctgggaccaagaagacatggaggtgttcggcagcacgagcagt
agcgagccacaggttgtgtttaccatgaagaacgcagcaacggttatgcgggagcatgaa
cgcaaagaggtaaatgatctgaaaatggttgatgagccaatggaagagggagagccagtt
tcttgccggcgggaagaattggttaaggagatacctattacacagcatgttaaagaagga
tacgagaaagcagatcccgcacagtttgacttgctcaaggttcttggtcagggatctttt
ggaaaggtttttcttgttagaaagaagactggtcctgatgctgggcagctctatgcaatg
aaggtgttaagaaaagcttctttgaaagttcgagaccgagttcgcacaaagatggagagg
gatatcttggtggaagtaaatcatccctttatcgtcaaactgcactatgcttttcagact
gaagggaagctgtacttaatattggatttcctcaggggaggagatgtcttcacaagatta
tccaaagaggttctttttacagaggaagatgtgaaattctaccttgcagaattggccctg
gctttggatcatctacatcgattaggaattgtttatagagacctgaaaccagaaaacatc
ttacttgatgaaataggacatatcaagttaacagattttgggcttagcaaagagtcagtg
gatcaagaaaagaaggcctactcattttgtggtactgtagaatatatggcccctgaagta
gtaaacagacgaggccattctcagagtgctgattggtggtcatatggtgtacttatgttt
gaaatgcttactggcactttgccatttcaagggaaagacagaaatgagaccatgaatatg
atactgaaagcaaaacttggaatgccccaattccttagtgctgaagcacaaagtctatta
aggatgttattcaaaaggaatccagcaaatagattggggtcagaaggagttgaagaagtc
aaaagacatgctttttttgcttccattgactggaataaactatataaaagagaagtccag
cctcctttcagacctgcttctggaaaaccggatgataccttctgttttgatcctgaattt
actgccaaaacacctaaagattctcctggtttgccagccagtgcaaacgctcatcaactc
ttcaaaggattcagttttgttgcgacttctattgccgaagaatataaaatcactcctgtt
acaagttcaaatgtattaccaatcgttcagataaatggaaatgctgctcaatttagtgaa
gcttatgaattgaaagaggatattggtattggttcttattctgtttgcaagcgatgcata
cactcagcttccaatgtggaatttgcagtcaagatcattgataaaaataagagagacccc
tcagaagaaattgaaattttgatgcgctatggacaacatcccaacattatctctttaaag
gaggtctttgatgatgggaaatatgtttaccttgttacggacttgatgaaaggaggagaa
cttctggatcggattctcaaaaagaaatgtttctcagagcaggaagctagtaatgtgctg
tatgtaataaccaagacagttgaatgccttcattctcaaggagtcgttcatcgtgatctt
aagcccagtaatattttatatatggatgagtcagcccatccagattcaatcaagatctgt
gattttgggtttgcaaaacagcttcgtggagaaaatggacttctgttaactccgtgctac
accgcaaactttgtagcacctgaggttctcactcaacagggatatgatgctgcctgtgat
atttggagcttaggagtccttttgtacacaatgttggctggctacactccattttccaac
ggccccaatgatactcctgaggaaatactgctgcgcataggcaacgggaggttctctttg
agtggtggaatctgggacaatatttcacgtggagcaaaggatttgctttctcatatgctt
cacatggacccacatcagcgttatactgctgagcaagtattaaagcacccttggataacc
caaagagaacaactgccgcgccatcagccaaactcagatgagccaccacaggaagcagtg
gcagcaccatattctgtcttggctcggaacccaaacaggcatcatccaatcctggagcct
gttactgcttcacgtttagctcagaggcggaacatgaaaaagcgaacatcaactggcttg
taa

DBGET integrated database retrieval system