KEGG   Mus musculus (mouse): 67266Help
Entry
67266             CDS       T01002                                 

Gene name
Fam69a, 2900024C23Rik, AI315274
Definition
(RefSeq) family with sequence similarity 69, member A
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: PIP49_C PIP49_N
Motif
Other DBs
NCBI-GeneID: 67266
NCBI-ProteinID: NP_080338
MGI: 1914516
Ensembl: ENSMUSG00000029270
Vega: OTTMUSG00000028903
UniProt: Q9D6I7
Position
5 F; 5
AA seq 428 aa AA seqDB search
MARSLCAGAWLRKPHYLQARLSYMRVKYLFFSWLVVFVGSWIIYVQYSTYTELCRGKDCK
KIICDKYKTGVIDGPACNSLCVTETLYFGKCLSNKPSNQMYLGVWDNLPGVVKCQMEQAL
HLDFGTELEPRKEIVLFDKPTRGTTVQKFKEMVYSLFKAKLGDQGNLSELVNLILTVADG
DRDGQVSLGEAKSAWALLQLNEFLLMVILQDKEHTPKLMGFCGDLYVMESVEYTSLYGIS
LPWVMELFIPSGFRRSMDQLFTPSWPRKAKIAIGLLEFVEDVFHGPYGNFLMCDTSAKNL
GYNEKYDLKMVDMRKIVPETNLKELIKDRHCESDLDCVYGTDCRTSCDLSTMKCTSEVIQ
PNLAKACQLLKDYLLHGAPSEIREELEKQLYSCIALKVTANQMEMEHSLILNNLKTLLWK
KISYTNDS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggagtctctgcgcgggggcctggctgaggaaaccccattacctccaggctcgg
ttgtcctacatgcgggtgaagtatcttttcttttcctggctggtggtttttgtcggaagc
tggatcatatatgtgcagtattcaacctatacagagctatgcagagggaaggactgtaag
aaaatcatatgtgacaaatacaagaccggagttattgacggacctgcatgcaacagcctc
tgtgtcacagaaacactgtactttggaaaatgtctgtccaacaagcccagcaaccagatg
tatttaggagtttgggataatctaccaggtgttgtgaagtgtcaaatggaacaagctctt
catcttgattttggaactgaattggagccaagaaaagaaatagtgctatttgataaacca
accaggggaactactgtacagaaattcaaagaaatggtgtacagtctctttaaggcaaaa
ttaggtgaccaagggaacctctctgaattggttaatctcatcttgacagtggctgacgga
gacagagatggccaggtctccctaggagaagccaagtcagcatgggcacttcttcagttg
aatgagtttctcctgatggtgatacttcaagataaagaacacacccccaaactaatggga
ttctgtggtgatctctacgtgatggaaagtgttgaatatacctctctgtatggaataagt
ctaccatgggttatggaactttttattccatctgggttcagaaggagcatggatcaattg
ttcacaccatcatggcccagaaaggcaaagatagccataggacttctagaatttgtagag
gatgttttccatggcccctatggaaactttctcatgtgtgacaccagtgccaaaaaccta
ggatataatgagaagtatgacttgaaaatggtggatatgagaaaaattgtgccagagaca
aacctaaaggaacttattaaggaccgccactgtgagtctgacctggactgtgtctacggt
acagactgtagaactagctgtgacctgagtacaatgaagtgcacttctgaagtaatacaa
ccaaacttggcaaaagcctgtcagttactcaaagactacctactgcacggtgctcccagt
gaaattcgggaagaattagaaaaacagctttattcttgtattgctctcaaagtcacagca
aatcaaatggaaatggaacattctttgatattaaataacctaaaaacgttattgtggaag
aaaatttcctacacaaatgactcttag

DBGET integrated database retrieval system