KEGG   Mus musculus (mouse): 67266Help
Entry
67266             CDS       T01002                                 

Gene name
Fam69a, 2900024C23Rik, AI315274
Definition
family with sequence similarity 69, member A
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 E5; 5
AA seq 428 aa AA seqDB search
MARSLCAGAWLRKPHYLQARLSYMRVKYLFFSWLVVFVGSWIIYVQYSTYTELCRGKDCK
KIICDKYKTGVIDGPACNSLCVTETLYFGKCLSNKPSNQMYLGVWDNLPGVVKCQMEQAL
HLDFGTELEPRKEIVLFDKPTRGTTVQKFKEMVYSLFKAKLGDQGNLSELVNLILTVADG
DRDGQVSLGEAKSAWALLQLNEFLLMVILQDKEHTPKLMGFCGDLYVMESVEYTSLYGIS
LPWVMELFIPSGFRRSMDQLFTPSWPRKAKIAIGLLEFVEDVFHGPYGNFLMCDTSAKNL
GYNEKYDLKMVDMRKIVPETNLKELIKDRHCESDLDCVYGTDCRTSCDLSTMKCTSEVIQ
PNLAKACQLLKDYLLHGAPSEIREELEKQLYSCIALKVTANQMEMEHSLILNNLKTLLWK
KISYTNDS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggagtctctgcgcgggggcctggctgaggaaaccccattacctccaggctcgg
ttgtcctacatgcgggtgaagtatcttttcttttcctggctggtggtttttgtcggaagc
tggatcatatatgtgcagtattcaacctatacagagctatgcagagggaaggactgtaag
aaaatcatatgtgacaaatacaagaccggagttattgacggacctgcatgcaacagcctc
tgtgtcacagaaacactgtactttggaaaatgtctgtccaacaagcccagcaaccagatg
tatttaggagtttgggataatctaccaggtgttgtgaagtgtcaaatggaacaagctctt
catcttgattttggaactgaattggagccaagaaaagaaatagtgctatttgataaacca
accaggggaactactgtacagaaattcaaagaaatggtgtacagtctctttaaggcaaaa
ttaggtgaccaagggaacctctctgaattggttaatctcatcttgacagtggctgacgga
gacagagatggccaggtctccctaggagaagccaagtcagcatgggcacttcttcagttg
aatgagtttctcctgatggtgatacttcaagataaagaacacacccccaaactaatggga
ttctgtggtgatctctacgtgatggaaagtgttgaatatacctctctgtatggaataagt
ctaccatgggttatggaactttttattccatctgggttcagaaggagcatggatcaattg
ttcacaccatcatggcccagaaaggcaaagatagccataggacttctagaatttgtagag
gatgttttccatggcccctatggaaactttctcatgtgtgacaccagtgccaaaaaccta
ggatataatgagaagtatgacttgaaaatggtggatatgagaaaaattgtgccagagaca
aacctaaaggaacttattaaggaccgccactgtgagtctgacctggactgtgtctacggt
acagactgtagaactagctgtgacctgagtacaatgaagtgcacttctgaagtaatacaa
ccaaacttggcaaaagcctgtcagttactcaaagactacctactgcacggtgctcccagt
gaaattcgggaagaattagaaaaacagctttattcttgtattgctctcaaagtcacagca
aatcaaatggaaatggaacattctttgatattaaataacctaaaaacgttattgtggaag
aaaatttcctacacaaatgactcttag

DBGET integrated database retrieval system