KEGG   Mus musculus (mouse): 67300Help
Entry
67300             CDS       T01002                                 

Gene name
Cltc, 3110065L21Rik, CHC, R74732
Definition
clathrin, heavy polypeptide (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
mmu  Mus musculus (mouse)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    67300 (Cltc)
   04142 Lysosome
    67300 (Cltc)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    67300 (Cltc)
  Nervous system
   04721 Synaptic vesicle cycle
    67300 (Cltc)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    67300 (Cltc)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    67300 (Cltc)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   67300 (Cltc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 C; 11
AA seq 1675 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANASGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYKAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLR
KEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atggcccagattctgcccattcgctttcaggagcatctccagctccagaacctgggtatc
aacccagcaaacattggcttcagtaccttgactatggagtcagacaaattcatctgcatt
agagaaaaagtgggagagcaggcccaggtggtaatcattgatatgaatgatccaagtaat
ccaattcgaagaccaatctcagcagacagtgccatcatgaatcctgccagcaaagtgatt
gcactgaaagctggcaaaactcttcagatatttaacattgaaatgaaaagtaaaatgaag
gcccataccatgactgatgatgtcaccttctggaaatggatctctttgaatacggttgct
cttgttacggataatgcagtttatcactggagtatggaaggagagtctcagccagtgaaa
atgtttgatcgtcattctagcctcgcaggatgccagatcatcaattaccgtacagatgca
aagcagaaatggttgcttctcactggcatatctgcacagcaaaatcgtgtggttggagct
atgcagctgtattctgtagataggaaagtttctcagcctattgaagggcatgcagctagt
tttgcacaatttaagatggaaggaaatgcagaagaatcaacattattttgttttgctgtg
cggggtcaggcaggaggaaagttacatatcattgaagttggtaccccacccacagggaat
caacccttcccaaagaaggcagtggatgttttctttcctccagaagcacaaaatgacttt
cctgttgcaatgcagatcagtgaaaagcatgatgtggtgttcttgattaccaagtatggt
tatattcacctctatgatcttgagactggcacgtgcatctacatgaacagaatcagcgga
gaaaccatcttcgtcactgcacctcatgaagccacagctggaataataggagtcaacaga
aagggacaggtcctgtcagtttgtgtggaagaggagaacataattccttatatcaccaat
gtcctacaaaatcctgacttggctctgagaatggctgtgcggaacaacttagctggtgct
gaagaactctttgcccggaaatttaatgctctcttcgcccagggaaactactcagaggct
gcaaaggtggctgctaatgctccaaagggaatccttcgtactccagataccatccgtcga
ttccagagtgtcccagctcagccaggtcaaacgtcacctctacttcagtatttcggaatc
cttttggaccagggccagctgaacaaatacgagtccttagagttatgtagacctgtactt
cagcaagggcggaaacagcttttggagaaatggctgaaagaagataagctggaatgttct
gaagaactgggtgatctcgttaaatctgtggacccaacattagcactgagtgtttacctc
agggccaatgtacctaataaagtcatccagtgctttgcagagacaggccaagtccagaag
attgttttatatgctaaaaaagttggctatactccagactggatctttctcctgagaaat
gtcatgcggatcagtccagatcaaggacagcagtttgctcaaatgttagttcaggatgaa
gagcctcttgctgatatcacccagattgtggatgtctttatggaatacaatctaatccaa
caatgtactgccttcttacttgatgctttgaagaataatcgtccctctgaaggtcctttg
cagacgcgattgcttgagatgaaccttatgcacgcacctcaagttgcagatgccattctc
gggaatcagatgttcacccactatgaccgggctcatatcgcccagctgtgtgagaaggcg
ggcctgctgcagcgtgcattagaacacttcaccgatttatatgacataaaacgtgcagtt
gttcatacccatcttcttaaccctgagtggttagtgaattactttgggtccttatcagtt
gaagattccctagaatgcctcagagccatgctgtcagctaatattcgtcaaaatctacag
atctgtgttcaggtggcttctaaatatcacgaacagctgtcaactcagtctctgattgag
ctctttgaatcattcaagagttttgaaggtctcttttattttctggggtccattgttaac
tttagtcaggacccagatgtgcactttaaatatattcaggcggcttgcaagactgggcaa
atcaaagaagtggaaagaatctgcagagaaagcaactgctatgatcccgagcgagtcaag
aattttctcaaggaggcaaaactaacagatcagttgccacttatcattgtctgtgatcgg
tttgactttgtccatgacctggtgctgtatttatatagaaacaatcttcagaagtatata
gagatatatgtccagaaggtaaatccaagtcgacttcctgtggttattggaggattgctg
gatgttgactgctctgaagatgtcattaaaaatttgattcttgttgtgagaggtcaattc
tctactgatgagcttgttgctgaagtcgagaaaagaaacagattgaagctgcttcttcct
tggcttgaggccagaattcatgagggctgtgaggagcctgctactcacaatgcacttgcc
aaaatatacattgacagtaacaacaacccagagagatttcttcgtgaaaacccttattat
gacagtcgtgttgttgggaagtactgtgagaagagagacccccatctggcttgtgttgct
tatgaacgtggccagtgtgacctggagctcatcaatgtttgcaatgagaattccctcttc
aaaagcctttctcgctacttagtccgtcgaaaggatccagaattgtggggtagtgtgcta
ctggaaagcaatccatacagaagaccgttaattgaccaggttgtacagacagccttgtct
gaaactcaggacccagaagaagtgtcagtaactgtgaaggcttttatgacagcagatctt
cctaatgagctcattgaactgctggagaaaatcgttcttgataactccgtattcagtgag
cacaggaatctgcaaaatctcctcatcctcactgcaattaaggctgaccgaacacgtgtt
atggagtatattaaccgcctggataattatgatgctccagatattgccaacattgccatc
agcaatgagctgtttgaagaggcatttgctattttccggaagtttgatgtcaatacttca
gcagtgcaggtgttgattgaacatattggaaacctggatcgtgcatatgagtttgctgaa
cgctgcaatgagcctgctgtttggagtcaacttgcaaaagctcagttgcagaaaggaatg
gtgaaggaagccattgattcttacatcaaagcagatgatccttcatcttacatggaagtt
gtccaggctgccaatgccagcggaaactgggaagaattggtgaagtatttgcagatggca
cgcaagaaggctcgagagtcctatgtggagacagaattgatatttgcactggctaaaaca
aaccgccttgcagaattagaagagttcatcaatgggccaaataatgctcatattcagcaa
gttggtgaccgttgttatgatgaaaaaatgtatgatgctgctaagttgttgtacaataat
gtttctaactttggacgcttggcatctacccttgttcaccttggcgagtatcaggcagca
gttgatggtgccagaaaagctaatagtactcgaacatggaaagaggtctgctttgcctgt
gtagatgggaaagagttccgccttgctcagatgtgtggactccatattgtggtgcatgca
gatgaattagaggagcttatcaactactatcaggatcgtggatattttgaagaactcatc
accatgttggaggcagccttgggactggagcgagctcacatgggaatgttcacagagcta
gctattttgtattctaaattcaagccacagaaaatgagagaacacctggagttgttctgg
tcgagagtgaatattcctaaggtgctgagagctgcagaacaggctcatctctgggcagag
ctggtgtttctgtatgacaagtacgaagagtatgacaatgccatcattaccatgatgaat
caccccaccgatgcatggaaggaagggcagttcaaagacatcatcaccaaggtggctaat
gtggaactgtactacaaagcaatccagttctacttagaattcaagcctttgttgttaaat
gacttgctcatggtgctgtctccacggttggatcacactcgtgcagtcaattatttcagc
aaggtaaaacagctaccactggtgaaaccatatttacgctcagtgcagaaccacaacaac
aaatctgtgaatgaatcactgaacaacctctttattactgaagaagattaccaggctctg
cgaacatcaatagatgcttatgacaactttgacaacatctcacttgctcagcgtttggaa
aaacacgaactcattgaattcagaagaattgctgcttatctcttcaaaggcaacaatcgc
tggaaacagagtgtagagttgtgcaagaaagacagcctttacaaggatgcaatgcagtat
gcctctgaatctaaagacacagaattggctgaagagctcctacagtggtttttgcaggaa
gaaaaaagagaatgctttggagcttgtctctttacctgttatgatctcttaaggccagat
gtcgtcctggaaaccgcatggagacataatatcatggatttcgccatgccctatttcatc
caggtcatgaaggaatatttgaccaaggtggataaattagatgcttcggagtcgctgaga
aaagaagaagaacaagctacagagacacagcccattgtttatggtcagccccagctgatg
ctaacagcaggacccagtgtggcagtccctccccaggcaccttttggttatggttatact
gcaccaccgtatgggcagccacagcctggctttgggtacagcatgtga

DBGET integrated database retrieval system