KEGG   Mus musculus (mouse): 67328Help
Entry
67328             CDS       T01002                                 

Gene name
Lyzl1, 1700038F02Rik, Lyc2
Definition
lysozyme-like 1 (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     67328 (Lyzl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
18 A1; 18
AA seq 148 aa AA seqDB search
MKSVGVFALIISFSIVAESKIYTRCKLAKIFAKAGLDNYGGFALGNWLCMAYYESHYNTT
AENVLEDGSTDYGIFQINSFTWCRNARKHQKNHCHVACSALITDDLTDAILCAKKIVKET
QGMNYWQGWKKNCENKDMSEWKRGCEVS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctgttggtgtcttcgccctaattatcagcttcagcatagtcgcagaatccaaa
atctacactcgatgtaaactggcaaaaatctttgcaaaggccggcctggacaattacggg
ggatttgcccttggaaactggctctgcatggcatactatgagagccactacaacactaca
gccgagaatgtcctggaggatggaagcactgactatggcattttccagataaacagtttc
acatggtgcagaaatgcaagaaagcatcagaagaatcactgccatgttgcctgctcagcc
ttgatcactgatgacctcacagatgccattctctgtgccaagaaaattgttaaagagaca
caagggatgaactattggcagggctggaagaagaactgtgagaacaaagacatgtcagag
tggaagagaggatgtgaggtttcctga

DBGET integrated database retrieval system