KEGG   Mus musculus (mouse): 67333Help
Entry
67333             CDS       T01002                                 

Gene name
Stk35, 1700054C12Rik, CLIK1, Stk35l1
Definition
(RefSeq) serine/threonine kinase 35 (EC:2.7.11.1)
  KO
K08859  
serine/threonine kinase 35 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     67333 (Stk35)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  NKF4 family
   67333 (Stk35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 F1
AA seq 539 aa AA seqDB search
MGHQESPLTRAAAGGAAYIKRLRKVLSWRELGDGHGNLEAEASPGSVAVITRAAPRRATR
SARLPASRPTRLCRQARLGTDHPPARAPRGNRFARKRNSAGQITIQGPAPPHLGARRRDE
ARGARAAPLLLPPPPAAMETGKENGARRGTKSPERKRRSPVQRVLCEKLRPAAQAMDPAG
AEVPGEAFLARRRPDGGGGDVPARPRYSLLAEIGRGSYGVVYEAVAGRSGARVAVKKIRC
DAPENVELALAEFWALTSLKRRHQNIVQFEECVLQRNGLAQRMSHGNKNSQLYLRLVETS
LKGERILGYAEEPCYLWFVMEYCEGGDLNQYVLSRRPDPATNKSFMLQLTSAIAFLHKNH
IVHRDLKPDNILITERSGTPILKVADFGLSKVCAGLAPRGKEGNQDNKNVNVNKYWLSSA
CGSDFYMAPEVWEGHYTAKADIFALGIIIWAMIERITFIDSETKKELLGTYIKQGTEIVP
VGEALLENPKMELHIPQKRRTSMSEGVKQLLKDMLAANPQDRPDAFELETRMDQVTCAA
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgggccaccaggaatctccgctgaccagagcggcggcgggaggtgcagcttacataaag
aggttacgtaaagtgctcagctggcgtgaactcggggacggccacgggaacctggaagcc
gaggcctcccccgggagcgttgctgtcatcacaagagcagcgccgcgacgcgctacacgc
tcagccaggctccccgcctcgcgccctacccggctctgcagacaagcccggctcggaacg
gaccatcctccggcgcgggctccaagggggaaccggttcgcccggaagaggaacagcgcc
ggccagatcaccatccaaggtcccgctcctccacatctcggggctagacggagggatgag
gcaaggggggcccgggcggcgccgttgctgctccccccgccccccgcagccatggaaacg
gggaaagagaacggagcccgcagagggacaaaaagcccggagcggaaaaggcgaagccca
gtccagcgggtactgtgcgagaagctgaggccggcggcccaggccatggatccggctggg
gccgaggtcccgggcgaggccttcctggcccggcggcggccggatggcggcggcggggat
gttcctgcacggccgcgctacagcctcttggcggagatcgggcgcggcagctacggcgtg
gtttatgaggctgtggctgggcgcagtggggccagggtggcagtcaagaagatccgctgc
gacgctcccgagaacgtggagttggcactagcagaattctgggccctcaccagtctcaag
cggcggcaccagaatatcgtgcagtttgaggagtgcgtcctacagcgcaacgggttagcc
cagcgcatgagtcacggcaacaagaactcacagctttacctgcgcctggtggagacctcg
ctcaaaggagaaaggatcctgggctatgctgaggagccctgctatctctggtttgtcatg
gagtactgtgaaggtggagacctcaatcagtatgtcctgtcccggagacctgacccagcc
accaacaaaagtttcatgctacagcttacaagcgccattgccttcctgcataaaaaccac
atcgtgcacagggacctaaagccagacaacatcctgatcacagagcggtctggcaccccc
atcctcaaggtggcagactttggactgagcaaggtctgtgcagggctggcaccccgaggc
aaagagggcaatcaagataacaaaaatgtgaatgtgaataaatactggctgtcctcagct
tgtggctcagacttctacatggctcccgaagtctgggagggacactatacagccaaggcg
gacatctttgctctgggcattatcatctgggcaatgatagaaagaattacctttattgac
tctgaaaccaagaaggagctcctggggacctacattaagcaagggactgagatcgtccct
gttggtgaggcgctgctagaaaacccaaagatggagttgcatatcccccagaaacgtagg
acttccatgtctgagggggtcaagcagctcttgaaagacatgttagctgctaacccacag
gaccgacctgatgcttttgaacttgaaacccgaatggaccaggtcacatgtgctgcttaa

DBGET integrated database retrieval system