KEGG   Mus musculus (mouse): 67426Help
Entry
67426             CDS       T01002                                 

Gene name
Adck3, 4632432J16Rik, AI462003, Cabc1, mKIAA0451
Definition
(RefSeq) aarF domain containing kinase 3
  KO
K08869  
aarF domain-containing kinase
Organism
mmu  Mus musculus (mouse)
Brite
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Atypical group
  ABC1 family
   67426 (Adck3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 H4
AA seq 645 aa AA seqDB search
MAAMLGDAIMVAKGLAKLTQAAVETHLQNLGLGGELLLAARALQSTAVEQFSMVFGKVQG
QDKHEDSYATENFEDLEAEVQFSTPQAAGTSLDFSAASSLDQSLSPSHSQGPAPAYASSG
PFREAGLPGQATSPMGRVNGRLFVDHRDLFLANGIQRRSFHQDQSSVGGLTAEDIEKARQ
AKARPESKPHKQMLSERARERKVPVTRIGRLANFGGLAVGLGIGALAEVAKKSLRSENST
GKKAVLDSSPFLSEANAERIVSTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFERVRQS
ADFMPLKQMTKTLNSDLGPHWRDKLEYFEERPFAAASIGQVHLARMKGGREVAMKIQYPG
VAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELTLECDYQREAAYAKKFRELLK
DHPFFYVPEIVDELCSPHVLTTELISGFPLDQAEGLSQEVRNEICYNILVLCLRELFEFH
VMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQVIRAAADQDREAVLKKSIE
MKFLTGYEVKAMEDAHLDAILILGEAFASEEPFDFGTQSTTEKIHNLIPVMLKHRLIPPP
EETYSLHRKMGGSFLICSKLKARFPCKAMFEEAYSNYCRMKSGLQ
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggctgctatgttgggggatgccatcatggtggccaaaggccttgccaagctgacccaa
gcagcggtggaaacccacttgcagaacctgggccttggtggggagctcctcctggcggcc
agggccctgcagtctacagctgtggagcagttcagcatggtcttcgggaaggtgcagggt
caggataagcatgaagattcatatgccactgagaactttgaagatctggaagccgaagtt
cagttctcaacaccacaggcagctggaacctccctggacttctctgcggcctcttccctg
gaccagtcactgtctccatcccacagtcagggaccggcccctgcctatgcttccagtggg
cctttcagggaagctgggctccctggacaggccacctctcctatgggcagagtcaatgga
aggctctttgtagatcacagagacttgttcttggccaacggcatccagcgaagatccttc
caccaggaccagtcctccgtgggaggcctcacggctgaagacattgaaaaggcccggcag
gccaaggctcgccctgagagcaagccacacaagcagatgctcagtgagcgggctcgggag
cggaaggtgccagttacccggattgggcggttggccaactttggaggtctggctgtaggt
ctgggaattggggcgttggctgaagttgccaagaagagtctgcgttctgagaactccaca
ggaaaaaaagccgtgctggattctagccccttcctgtcagaggcaaatgcagagcgcatt
gtgagtacactgtgcaaggtgcgtggggccgcactgaagctgggccagatgctgagcatc
caggatgatgccttcatcaaccctcacctggccaagatctttgagcgggtgaggcagagt
gctgacttcatgccactgaaacagatgacgaaaaccctcaacagcgacctgggcccccac
tggagggacaagctggagtactttgaagagcggccctttgcagcggcctccatagggcag
gtgcacctggcccgcatgaagggtggccgtgaggtggccatgaagatccagtaccctggt
gtggcccagagcattaacagtgacgtcaacaacctcatggctgtgctgaacatgagtaac
atgcttccagaaggcctgttccctgagcacctgattgatgtgctgagacgggagcttacc
cttgagtgtgactaccagcgggaggctgcctatgccaagaagttcagggaactgctgaag
gaccatcccttcttctatgtgcctgagattgtggatgagttgtgcagtccccatgtgctg
accacagagctcatatcaggcttccccttggaccaggcagaagggctgagccaggaagtg
aggaatgagatctgctacaacattttggtgctgtgcctgagagagctgtttgagttccat
gtcatgcagactgaccccaactggtccaatttcttttatgaccctcagcagcacaaggtg
gctctcctggacttcggcgcaactagagaatatgacagatcctttactgacctctacatt
caggtcatccgggccgctgctgaccaggacagggaggcagtgctaaagaaatccatagag
atgaagttccttaccggttatgaggtcaaggccatggaggatgctcacctggatgctatt
ctcatcctgggggaggcctttgcctccgaagagcccttcgacttcggtacccagagcact
actgagaagatccacaacctgattcccgtcatgctgaagcaccgcctcatcccaccccca
gaggagacctactctctgcaccgcaagatgggtggctctttcctcatctgctctaagctg
aaggcccgcttcccctgtaaggccatgttcgaggaagcgtacagtaactactgcaggatg
aagtctgggctgcagtag

DBGET integrated database retrieval system