KEGG   Mus musculus (mouse): 67473Help
Entry
67473             CDS       T01002                                 

Gene name
Slc47a1, 1300013J15Rik, AI036982, MATE1, mMATE1
Definition
(RefSeq) solute carrier family 47, member 1
  KO
K03327  
multidrug resistance protein, MATE family
Organism
mmu  Mus musculus (mouse)
Brite
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   67473 (Slc47a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 B2
AA seq 567 aa AA seqDB search
MERTEESAPGPGGADAASERRGLRCLLLPGFLEELRALLVLAGPAFLAQLMMFLISFISS
VFCGHLGKLELDAVTLAIAVINVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQRGT
LILLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMIFIPALPAAFLYTLQVKYLLN
QGIVLPQIMTGIAANLVNALANYVFLYHLHLGVMGSALANTISQFALAIFLFLYILWRRL
HQATWGGWSWECLQDWASFLRLAIPSMLMLCIEWWAYEVGSFLSGILGMVELGAQSITYE
LAIIVYMIPSGFSVAANVRVGNALGAGNIDQAKKSSAISLIVTELFAVTFCVLLLGCKDL
VGYIFTTDRDIVALVAQVIPIYAVSHLFEGLACTCGGILRGTGNQKVGAIVNAIGYYVIG
LPIGIALMFAAKLGVIGLWSGIIICTTCQTTCFLAFIARLNWKRACQQAQVHANLKVNVA
LNSAVSHEPAHPVCPESHGEIMMTDLEKKDETQLDQPMNQQQALPIRPKDSNKLSGKQLA
LRRGLLLLGVVLVLVGGILVRVYIRIE
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcacggaggagtccgctcccgggccgggaggcgcggacgctgcgtccgagcgc
cgtgggctacgctgcctgctgctgcccggcttcctagaggagctgcgggcactcttggtc
ctggcgggtcctgcgttcttggcccagctgatgatgttcctaatcagtttcataagctca
gtgttctgtggccacttgggcaagctggagttggatgcagtcacactggcaattgcggtt
atcaatgtcacaggcatttcagtgggacatggcttgtcttctgcttgtgacacgctcatc
tcccagacatacgggagccagaacttaaagcacgtaggggttatcctgcaaagggggaca
ctcatcctgctcctctgctgctttccctgctgggcactcttcatcaacaccgagcaaatt
ctgctgctcttcagacaggacccggatgtatccaggctcacccagacttacgtcatgatc
ttcatcccagcgcttcctgcagcttttctttatacgttacaagttaaatacttgctcaac
cagggcatcgttctgcctcagattatgacgggcatcgcagctaaccttgtcaacgccctg
gccaactatgtgtttctctatcacctgcatcttggggtgatgggttcagcattggccaac
accatctcccagtttgccctggccattttcctgttcctctacatcctctggagaagacta
caccaagccacctggggagggtggtcctgggagtgtctgcaggactgggcctccttcctg
cgactggctatccccagcatgctcatgctgtgcatagagtggtgggcctatgaggttggc
agcttcctgagtggtatccttggcatggtggagttgggagcccagtccatcacctatgaa
ttggctatcattgtatacatgatcccttcaggcttcagtgtggctgccaacgtccgggtg
ggaaatgcactgggcgcaggaaacattgaccaggccaagaagtcctcagctatttccttg
atagtcacagagctctttgctgtgaccttctgcgtcctgctgctaggctgtaaggatctc
gtgggctacattttcactaccgatcgggatatcgtggccttggtggctcaagtgatcccc
atttatgctgtgtcccacctctttgaaggtcttgcttgtacctgtggtggtatcctgagg
ggcactgggaaccagaaggttggagccatcgttaatgccatcgggtattatgtcattggc
ctccccatcgggatcgcgctgatgtttgctgctaagctgggagtgatcggcctgtggtca
ggcatcatcatctgcactacctgtcagaccacgtgcttcctggcttttattgctcggctc
aattggaaacgcgcctgtcaacaggctcaagtacatgccaatttgaaggtaaacgtggcc
ctgaattccgctgtctctcacgagcctgctcacccagtgtgtcctgagagccatggagaa
attatgatgacggatcttgaaaaaaaagacgagactcagttggaccagccgatgaaccag
caacaagctttgcctatccgtccaaaggacagcaataaactgtctgggaaacagttggcc
ttacggagaggactcctgctcctaggggtagtcttagtcttggtgggtgggattttagtg
agagtctatatcagaattgaataa

DBGET integrated database retrieval system