KEGG   Mus musculus (mouse): 67498Help
Entry
67498             CDS       T01002                                 

Gene name
Kcnv1, 2700023A03Rik, vibe
Definition
(RefSeq) potassium channel, subfamily V, member 1
  KO
K04934  
potassium channel subfamily V member 1
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNV, Kv8.x
   67498 (Kcnv1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15; 15 D1
AA seq 503 aa AA seqDB search
MDLSPRNRPLLDSSSLDSGSLTSLDSSVFCSEGEGEPLALGDCFTVNVGGSRFVLSQQAL
SCFPHTRLGKLAVVVASYRRLGALAAAPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYY
RTGRLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTDDQESQ
HESEQDFSKGPCPTVRQKLWDILEKPGSSTAARIFGVISIIFVAVSIVNMALMSAELSWL
NLQLLEILEYVCISWFTGEFVLRFLCVKDRCHFLRKVPNIIDLLAILPFYITLLVESLSG
SHTTQELENVGRLVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGI
SIFSTIEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGI
LVLALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIM
EMLRLKGRERASTRSSGGDDFWF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctgtcaccccgcaaccggccgctactggactcgtcgtcgctggacagcggttct
ctgacctcactggactccagtgtcttctgtagcgagggcgaaggggaacccttggctctg
ggggactgctttacagtcaacgtgggcggtagccgcttcgtgctctcgcagcaagctctg
tcctgcttcccgcacacgcgcctgggcaaactggccgtagtggtggcctcctaccgccgc
ctgggtgccctggctgccgcccccagccccctggagctttgcgatgatgcgaatccggtg
gacaacgagtacttctttgatcgcagctctcaggcgttccgttatgtcctgcactactat
cgcactggtcgcctgcatgtcatggagcagctctgtgcgctctcctttcttcaggagatc
cagtactggggcatagatgaactcagcattgactcctgctgcagggacagatacttcaga
agaaaggagctgagtgaaactcttgactttaagaaggacacagatgaccaggaaagtcaa
catgagagtgaacaggacttctcaaaaggaccttgtcccactgtccgacaaaagctctgg
gatattctggagaaacctggatcttccacagcagcccggatctttggagtaatctccatc
atttttgtggcagtgtccatcgtcaacatggccctgatgtcagctgagcttagctggctc
aacctacagctgctggagatcttggagtatgtgtgcatcagctggttcaccggggagttc
gttctgcgcttcctatgtgtgaaagacaggtgccacttcctgaggaaggttccaaacatc
atagacctccttgccatcttgcccttctatataactcttctggtggaaagcctgagcggc
agccacaccacacaagagctggaaaatgtgggacgtctggtccaggtcttgaggctcctc
agagctctgcgcatgctgaaactgggaaggcattctacaggattgcgctcacttgggatg
acaatcactcagtgctatgaagaagttggcctactgctcctgtttctatctgtggggatt
tctatattttcaacaatagaatactttgcagagcaaagcattcctgatacaaccttcaca
agtgttccttgtgcatggtggtgggccacaacatccatgactacagtaggatatggggac
attagaccagacaccaccacaggcaaaatcgtggccttcatgtgtattctgtcaggaatc
cttgtcttggccttgcctattgccattattaatgatcgattctctgcttgctacttcacc
ttgaaactcaaggaagcagctgtgagacagcgtgaagctctcaagaaacttaccaagaat
atagccactgactcatatattagtgttaacttgagggatgtctatgcccggagcataatg
gagatgcttcgattaaagggcagggagagagcaagtactagaagcagtggtggagatgat
ttctggttttaa

DBGET integrated database retrieval system