KEGG   Mus musculus (mouse): 67669Help
Entry
67669             CDS       T01002                                 

Gene name
Hikeshi, 0610007P06Rik, 1110002N09Rik, l(7)6Rn, l7Rn6
Definition
(RefSeq) heat shock protein nuclear import factor
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 D3; 7 50.4 cM
AA seq 197 aa AA seqDB search
MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYENINHVVVFMLGTIPFPEGMGGSVYFSYPD
SNGVPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDS
LAQQTPVGSAAVSSVDSFTQFTQKMLDNFYNFASSFALSQAQMTPNPSEMFIPANVVLKW
YENFQRRLAQNPLFWKT
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttggctgcctggtggcggggaggctggtgcaaacagctgcacagcaagtggcagag
gataaatttgtttttgacttgcctgattatgaaaatatcaaccatgttgtggtttttatg
ctgggaacaatcccatttcctgagggcatgggaggatctgtctacttttcctatcctgat
tcaaatggggtgccagtgtggcagctcctaggatttgtcacgaatggaaagccaagtgcc
atcttcaaaatatcaggtcttaaatctggggaaggaagccagcacccatttggagccatg
aatattgtgcgaaccccatctgttgcccagattggcatctcggtggaattgttggacagt
ctggctcagcagactcctgtaggcagtgctgccgtgtcctccgttgactcctttacgcag
ttcacacagaagatgttggacaacttctacaattttgcttcatcatttgctctctctcag
gcccagatgacaccaaatccatcagaaatgttcatcccagcaaatgtggttctgaaatgg
tatgaaaactttcaaagacgactagcacagaaccccctcttttggaaaacataa

DBGET integrated database retrieval system