KEGG   Mus musculus (mouse): 67712Help
Entry
67712             CDS       T01002                                 

Gene name
Slc25a37, 1700020E22Rik, 4930513O14Rik, 4930526G11Rik, AI848481, C330015G08Rik, Mfrn, Mfrn1, Mscp, frascati, mitoferrin
Definition
(RefSeq) solute carrier family 25, member 37
  KO
K15113  
solute carrier family 25 (mitochondrial iron transporter), member 28/37
Organism
mmu  Mus musculus (mouse)
Brite
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    67712 (Slc25a37)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   67712 (Slc25a37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
14; 14 D2
AA seq 338 aa AA seqDB search
MELRRGGVGNQAAGRRMDGDCRDGGCGSKDAGSEDYENLPTSASVSTHMTAGAMAGILEH
SIMYPVDSVKTRMQSLNPDPKARYTSIYGALKRIMHTEGFWRPLRGLNVMMMGAGPAHAM
YFACYENMKRTLNDVFSHQGNSHLANGVAGSMATLLHDAVMNPAEVVKQRLQMYNSQHQS
AFSCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPRRDYNPQSHIIS
GGLAGALAAAATTPLDVCKTLLNTQENMALSLANVSGRLSGMANAFRTVYQLNGLAGYFK
GIQARVIYQMPSTAISWSVYEFFKYILTKRQLENRTLY
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggagctccgccgtggcggcgtggggaaccaggctgcgggccggaggatggatggggac
tgccgcgatggcggctgcggcagcaaggacgccgggtcggaggactacgagaacctaccg
accagcgcctcggtgtccacccacatgacagcgggagcgatggccgggattctggagcac
tccatcatgtacccggtggactccgtgaagacacggatgcagagtttgaatccagatccc
aaagcccggtatacaagcatctatggcgccctcaagaggatcatgcacactgaaggcttc
tggaggcccctgcggggcctgaacgtgatgatgatgggtgcagggcccgcgcacgccatg
tattttgcctgctatgaaaacatgaaaaggactttaaatgacgttttcagccaccaagga
aacagccatctagctaatggggtagctgggagtatggccaccctactccacgatgcagta
atgaatccagcagaagtggtgaaacagcgcttacagatgtacaactcccagcaccagtca
gccttcagttgtatccggacagtgtggcggaccgaggggttgggggccttctacaggagt
tacaccacacagctgaccatgaatatccccttccagtcaattcacttcatcacctatgag
tttctgcaggagcaagtcaaccctcgccgggactacaacccacagtctcacatcatctca
ggaggcctggccggggcactggccgcagctgccaccaccccgctggacgtctgcaaaacc
ctcctcaacacgcaggagaacatggctctctccctggccaacgtcagcggccggctgtcg
ggcatggccaatgccttccggacggtgtaccagctcaacggccttgccggctatttcaaa
ggcatccaggctcgagtcatctaccagatgccttccaccgccatctcctggtccgtttat
gagttcttcaagtacatccttacaaagaggcagctggagaatcgaactctgtactaa

DBGET integrated database retrieval system