KEGG   Mus musculus (mouse): 67773Help
Entry
67773             CDS       T01002                                 

Gene name
Kat8, 2010203C02Rik, 5830450F21Rik, D7Ertd629e, MOF, MYST-1, Myst1
Definition
(RefSeq) K(lysine) acetyltransferase 8
  KO
K11308  histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     67773 (Kat8)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    67773 (Kat8)
   HAT complexes
    NSL complex
     67773 (Kat8)
    MSL complex
     67773 (Kat8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS Tudor-knot Myosin_head Acetyltransf_7 HTH_9 SAWADEE
Motif
Other DBs
NCBI-GeneID: 67773
NCBI-ProteinID: NP_080646
MGI: 1915023
Ensembl: ENSMUSG00000030801
Vega: OTTMUSG00000058634
UniProt: Q9D1P2
Structure
PDB: 

Jmol
Position
7 F3; 7 69.83 cM
AA seq 458 aa AA seqDB search
MAAQGATAAVAATTSGTVGEGEPGPGENAAVEGPARSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagctacagctgcagttgctgcaacaacttcaggaactgtaggggag
ggagagcccggcccgggggaaaatgcagcagtcgaggggcctgcccggtccccgggccgg
gtctctccgccgactccggcgcgtggcgaaccagaagtcaccgtggagatcggagaaacg
tacctgtgccggcggccggatagcacctggcattcagcagaagtgatccagtctcgagtg
aatgaccaggaaggccgagaagaattctatgttcactatgtgggctttaacaggcgactg
gacgaatgggtggacaagaaccgactcgcactgaccaagacagtgaaggatgccgtgcag
aagaactctgagaaatacctgagtgagctggccgagcagccagagcgcaagatcactcga
aaccaaaagcgaaagcatgatgagatcaaccatgtgcagaagacctatgcagagatggac
cccaccacagcagccttggaaaaggaacacgaggcgatcaccaaagtgaagtatgtagac
aagatccacattgggaactatgaaatcgatgcctggtatttctcacctttcccagaggac
tatgggaagcagcccaagctttggctctgcgagtactgcctcaaatacatgaagttcgag
aagagctaccgcttccacctgggccagtgtcagtggcggcagcccccagggaaggagatc
tatcgaaagagcaacatctctgtgtatgaagtggatggcaaagaccacaagatatactgt
cagaacctgtgtctactggccaagcttttcctggaccacaagaccttgtattttgatgtg
gagccctttgtcttttacattctgacagaagtagataggcaaggggctcacattgttggc
tacttttctaaggagaaggaatccccagatggaaacaacgtggcctgcatcttgaccctg
cctccctaccagcggcgtggctatgggaagtttctcatcgccttcagttatgagctctct
aagctcgagagtactgtaggctccccagagaagccactgagtgacctgggcaaactcagc
tacagaagctactggtcatgggtcttgctggagatcctgcgagacttccggggcacattg
tctatcaaagatcttagccagatgaccagcatcacccagaatgacatcatcagcaccctg
cagtccctcaacatggtcaagtactggaagggccagcatgttatctgtgtcacacctaag
ctggtagaggaacacctcaaaagtgcccagtataagaaaccacctatcacagtggactct
gtctgcctcaagtgggcacccccgaagcacaaacaagtcaagctttccaagaagtga

DBGET integrated database retrieval system