KEGG   Mus musculus (mouse): 67773Help
Entry
67773             CDS       T01002                                 

Gene name
Kat8, 2010203C02Rik, 5830450F21Rik, D7Ertd629e, MOF, Myst1
Definition
K(lysine) acetyltransferase 8 (EC:2.3.1.48)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     67773 (Kat8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
7 F3; 7 69.83 cM
AA seq 458 aa AA seqDB search
MAAQGATAAVAATTSGTVGEGEPGPGENAAVEGPARSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagctacagctgcagttgctgcaacaacttcaggaactgtaggggag
ggagagcccggcccgggggaaaatgcagcagtcgaggggcctgcccggtccccgggccgg
gtctctccgccgactccggcgcgtggcgaaccagaagtcaccgtggagatcggagaaacg
tacctgtgccggcggccggatagcacctggcattcagcagaagtgatccagtctcgagtg
aatgaccaggaaggccgagaagaattctatgttcactatgtgggctttaacaggcgactg
gacgaatgggtggacaagaaccgactcgcactgaccaagacagtgaaggatgccgtgcag
aagaactctgagaaatacctgagtgagctggccgagcagccagagcgcaagatcactcga
aaccaaaagcgaaagcatgatgagatcaaccatgtgcagaagacctatgcagagatggac
cccaccacagcagccttggaaaaggaacacgaggcgatcaccaaagtgaagtatgtagac
aagatccacattgggaactatgaaatcgatgcctggtatttctcacctttcccagaggac
tatgggaagcagcccaagctttggctctgcgagtactgcctcaaatacatgaagttcgag
aagagctaccgcttccacctgggccagtgtcagtggcggcagcccccagggaaggagatc
tatcgaaagagcaacatctctgtgtatgaagtggatggcaaagaccacaagatatactgt
cagaacctgtgtctactggccaagcttttcctggaccacaagaccttgtattttgatgtg
gagccctttgtcttttacattctgacagaagtagataggcaaggggctcacattgttggc
tacttttctaaggagaaggaatccccagatggaaacaacgtggcctgcatcttgaccctg
cctccctaccagcggcgtggctatgggaagtttctcatcgccttcagttatgagctctct
aagctcgagagtactgtaggctccccagagaagccactgagtgacctgggcaaactcagc
tacagaagctactggtcatgggtcttgctggagatcctgcgagacttccggggcacattg
tctatcaaagatcttagccagatgaccagcatcacccagaatgacatcatcagcaccctg
cagtccctcaacatggtcaagtactggaagggccagcatgttatctgtgtcacacctaag
ctggtagaggaacacctcaaaagtgcccagtataagaaaccacctatcacagtggactct
gtctgcctcaagtgggcacccccgaagcacaaacaagtcaagctttccaagaagtga

DBGET integrated database retrieval system