KEGG   Mus musculus (mouse): 67792Help
Entry
67792             CDS       T01002                                 

Gene name
Rgs8, 6530413N01Rik
Definition
(RefSeq) regulator of G-protein signaling 8
  KO
K16449  
regulator of G-protein signaling
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 G3; 1 65.41 cM
AA seq 180 aa AA seqDB search
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWAESFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVTKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNMQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggctgccttactgatgccacgcaggaacaaaggcatgaggactcgactggggtgcctg
tcacacaaatcagactcctgcagtgacttcactgccatcctccctgacaaacccaaccgt
gctctcaagagactctccacggaagaagcaacgaggtgggcggagtctttcgatgtgctt
ctctctcataagtatggggtggcagccttccgtgccttcttgaagacggagttcagcgag
gagaacctggagttctggctggcctgcgaggagttcaagaagaccaggtcaactgcaaag
ctagtcaccaaggcccacaggatctttgaggagtttgtggatgtgcaggctccacgggag
gtgaatatcgatttccagacccgagaggccacgaggaagaacatgcaagagccatccctg
acttgttttgatcaagctcagggaaaagtccacagcctcatggagaaagactcctaccct
aggttcctgaggtccaaaatgtacttagatctgctgtcccagagccagaggaggctcagc
tag

DBGET integrated database retrieval system