KEGG   Mus musculus (mouse): 67988Help
Entry
67988             CDS       T01002                                 

Gene name
Tmx3, 6430411B10Rik, A730024F05Rik, AV259382, Txndc10, mKIAA1830
Definition
thioredoxin-related transmembrane protein 3 (EC:5.3.4.1)
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     67988 (Tmx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
18 E4; 18
AA seq 456 aa AA seqDB search
MANAVGRRSWAALRLCAAVILLDLAVCKGFVEDLNESFKDNRKDDIWLVDFYAPWCGHCK
KLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPR
TKDDIIEFAHRVSGALIRPLPSQQMFDHVRKRHRVFFVYIGGESPLKEKYIDAASELIVY
TYFFSASEDVVPEYVTLKEMPAVLVFKDDTYFVYDEYEDGDLSSWISRERFQNYLTMDGF
LLYELGDTGKLVAIAVIDEKNTSLEHTRLKSIIQEVARDFRDHFHRDFQFGHMDGNDYIN
TLLMDELTVPTIVVLNTSNQQYFLLDRHIKDASDMVQFINSILDGTVPAQGGDSIFQRLK
RIVFDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGGYIEERYEVSKSEM
ENQEQIEESKEQESSSGGSLAPTVQEPKDVLEKKKD
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatgcagtggggcggaggagctgggcagccctccggctctgcgctgcggttatt
ttacttgatctggctgtttgtaaaggatttgtagaagatctaaatgaatcatttaaagat
aatcgaaaagatgacatttggcttgttgatttctatgcaccctggtgtggccattgtaaa
aagttggaaccaatttggaatgaagttgggcttgaaatgaaaagtattggttctccagtt
aaagttggaaagatggatgctacttcatattctagcattgcttcagagtttggagttcga
ggttatccaacaattaagctattaaagggagacttggcatataattaccgaggaccacgg
actaaagatgatataattgagtttgctcacagagtgtctggggctctaattcggcctctt
ccaagtcaacaaatgttcgaccatgtacggaagaggcaccgtgtattttttgtttatatt
ggtggagaatcacccttgaaagagaaatacatagatgctgcttcagagttaattgtatat
acatactttttttctgcctcagaagatgtggttcctgagtacgtgacgctgaaagagatg
cctgctgtgcttgttttcaaagatgacacttattttgtttatgatgagtatgaagatggc
gatctgtcctcatggatcagcagagagaggtttcagaactaccttactatggatggtttt
ctcctgtatgaacttggagacacaggaaagcttgtggccatagcagttattgatgagaaa
aacacatcacttgagcataccagattaaagtcaattattcaggaagttgctagagatttc
agagaccacttccatagagattttcagtttggccatatggatggaaatgactatataaac
actttgttgatggacgaattaacagtcccaacaatagttgtactgaatacttcaaaccaa
cagtactttttgctagatagacatattaaggatgcgagcgacatggtccagttcattaat
agcattttggatggtacagtaccagcccaaggaggtgatagcatttttcagagattgaaa
agaatagtatttgatgccaaatctacaattgtgtctatattcaagagctctccacttatg
ggctgctttcttttcgggctgccactgggtgtcatcagtatcatgtgctatggaatctat
acagctgacacagatggaggctatatagaagaacgatatgaagtatctaaaagtgaaatg
gaaaaccaggaacagatagaagagagcaaagagcaagagtccagcagtggagggtctcta
gcacctactgtgcaagagcccaaagatgtattagaaaagaagaaagattga

DBGET integrated database retrieval system