KEGG   Mus musculus (mouse): 68024Help
Entry
68024             CDS       T01002                                 

Gene name
Hist1h2bc, 2610022J01Rik, H2bfs, R74621
Definition
histone cluster 1, H2bc
Orthology
K11252  
histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    68024 (Hist1h2bc)
  Immune diseases
   05322 Systemic lupus erythematosus
    68024 (Hist1h2bc)
  Substance dependence
   05034 Alcoholism
    68024 (Hist1h2bc)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   68024 (Hist1h2bc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 A3.1; 13
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcctgcgaagtccgctcccgccccgaagaagggctccaagaaggccgtgacc
aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtgcaccccgacaccggcatctcctccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcccgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgcggtgtcggagggcaccaaggccgtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system