KEGG   Mus musculus (mouse): 68094Help
Entry
68094             CDS       T01002                                 

Gene name
Smarcc2, 5930405J04Rik
Definition
(RefSeq) SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2
  KO
K11649  
SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
mmu  Mus musculus (mouse)
Brite
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     68094 (Smarcc2)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Chromatin remodeling factors
   BAF complex
    68094 (Smarcc2)
   PBAF complex
    68094 (Smarcc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10; 10 D3
AA seq 1213 aa AA seqDB search
MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQ
EEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRN
VEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIVKRHQGTISEDKSNASHVVYP
VPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAK
WILDTDTFNEWMNEEDYEVSDDKSPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRK
RSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKT
VNTKKDSESAPVKGGTMTDLDEQDDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQ
THHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEY
LTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSG
LVPLQPKPPQQSSASQQMLNFPEKGKEKPADMQNFGLRTDMYTKKNVPSKSKAAASATRE
WTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLA
YQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVE
EAAKVTGKADPAFGLESSGIAGTASDEPERIEESGTEEARPEGQAADEKKEPKEPREGGG
AVEEEAKEEISEVPKKDEEKGKEGDSEKESEKSDGDPIVDPEKDKEPTEGQEEVLKEVAE
PEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLE
IKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQ
QPPTLPPGSQPIPPTGAAGPPTVHGLAVPPAAVASAPPGSGAPPGSLGPSEQIGQAGTTA
GPQQPQQAGAPQPGAVPPGVPPPGPHGPSPFPNQPTPPSMMPGAVPGSGHPGVAGNAPLG
LPFGMPPPPPAAPSVIPFGSLADSISINLPPPPNLHGHHHHLPFAPGTIPPPNLPVSMAN
PLHPNLPATTTMPSSLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLPDPGTPLPPDPTA
PSPGTVTPVPPPQ
NT seq 3642 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcggaagaaggacggcggccccaacgtgaagtactacgaggccgcggacacc
gtgacccagttcgacaacgtgcggctctggctcggcaagaactacaagaagtacatacaa
gcagaaccgccaaccaacaagtctctgtccagcctggtggtgcagttgctccagtttcag
gaagaggtttttggcaaacatgtcagcaacgcaccgcttactaaactgccgatcaaatgt
ttcctagatttcaaagcaggaggatccctctgccatattcttgcagctgcctacaaattc
aagagtgaccagggatggcggcgttacgatttccagaatccatcacgcatggaccgcaat
gtggaaatgttcatgaccattgagaagtccttggtacagaataattgcctgtcacgacct
aacattttcctctgcccagaaattgagcccaaactgctagggaaattaaaagacattgtt
aagagacaccagggaaccatctctgaggataagagcaatgcctcccatgttgtgtatcct
gtcccagggaacctagaagaagaggaatgggtacggccagtcatgaagagggataaacag
gttcttctgcactggggctactatcctgacagctacgacacgtggatcccagcgagtgaa
attgaagcatctgtggaggacgctcccactcctgagaaaccgaggaaggtccatgcgaag
tggatcctcgacaccgacacattcaacgagtggatgaatgaggaagactacgaagtcagt
gacgacaaaagcccagtctcccgcaggaagaagatctcagccaagacgctgacagacgag
gtaaacagcccagattcagacagacgagacaagaaggggggcaactataagaagaggaag
cgctctccctctccttcacccaccccagaggctaagaagaaaaacgctaagaaaggaccc
tcaacaccttataccaagtcaaagcgaggccacagagaagaggaacaagaagacctgaca
aaagacatggatgagccctctccagtcccaaacgtggaagaggtgacactccccaaaaca
gtcaacactaaaaaggactctgagtcagccccagtcaaaggcggcaccatgactgacctg
gatgaacaggacgatgaaagcatggagaccaccggcaaggacgaggatgagaacagcacg
ggcaacaaaggcgagcagacgaagaacccggacctgcatgaggacaatgtgaccgagcag
acccaccacatcatcatccccagctacgccgcctggtttgactacaacagcgtccatgcc
attgaacggagggctcttcctgagttcttcaacggcaagaacaagtctaagactccagag
atctacctggcgtatcggaacttcatgattgacacttaccgactgaatccccaggagtat
ctaacatctactgcctgtcggcggaatttggcgggtgatgtctgcgctatcatgagggtc
catgccttcctggaacagtggggtcttattaactaccaggtagatgctgagagccgacca
accccaatggggcctccacccacctctcacttccatgtcttggcggacacaccatcaggg
ctggttcctcttcagccgaagcctccacagcagagctctgcttcccagcaaatgctgaac
ttccctgagaagggcaaggagaaaccagcagacatgcagaattttgggctgcgcacagac
atgtacacaaagaagaacgtcccctccaagagcaaagctgcagcaagtgccactcgggaa
tggacggagcaggagactctgctgctcctggaggctttggaaatgtacaaggacgactgg
aacaaagtatctgagcacgtgggaagccgcacgcaggacgagtgcatcttgcattttctc
cgccttcccattgaagacccatacctggaggactcggaggcttctctaggccctctggcc
taccaacccatccccttcagtcagtcaggcaaccctgttatgagcaccgttgccttcctg
gcctctgtcgtcgatccccgagttgcctctgctgctgcgaagtcagccctagaagagttc
tcaaaaatgaaggaagaggtgcccacagctttggtggaagcccacgtgcgtaaggtcgaa
gaagcggccaaagtcacaggcaaggccgacccagcctttggtctggagagtagcggcatc
gcagggactgcctctgatgagcctgagcgcattgaggaaagcgggactgaggaggcacgg
ccagagggccaggcagcagatgagaagaaggagcctaaggaaccacgggaaggagggggc
gctgtggaggaagaagcaaaggaggaaataagtgaggtccccaagaaagatgaagagaaa
gggaaagaaggtgacagtgagaaggagtctgagaagagtgacggggacccgatagttgat
cctgagaaagacaaggaaccaacagaagggcaggaggaagtgctaaaggaagtggcagag
ccagagggggagaggaaaaccaaggtggagcgtgacattggtgaaggcaacctgtccaca
gctgcagccgcagccctggccgctgctgcagtcaaggccaagcacttggctgcagttgag
gagagaaagatcaagtctttggtggctctgctggtagagacccaaatgaagaaactagag
atcaaactccgacattttgaggagctggagacaataatggaccgggagcgagaggcgctg
gaataccagaggcagcagctcctggccgaccggcaagccttccacatggagcagctgaag
tatgcagagatgagggcccggcagcagcacttccagcagatgcaccagcagcagcagcag
cagccaccaaccttgcccccaggctcccagcccatacctcccaccggggctgctggacca
cctacagtccatggtctagctgtgcctccagccgctgtggcctctgcccctcctggcagt
ggggcccctcctggaagcttgggcccttctgaacagattgggcaggcagggacaactgca
gggccacagcagccacaacaagctggagcccctcagcctggggcagtcccaccaggggta
cccccccctggaccccatggcccctcaccgttccccaaccaaccaactcctccctcaatg
atgccaggggcagtgccaggcagcgggcacccaggcgtggcgggtaatgctcctttgggt
ttgccttttggcatgccgcctcctcctcctgctgctccatccgtcatcccattcggtagt
ctagctgactccattagtattaaccttccccctcctcctaacctgcatgggcatcaccac
catctcccgtttgccccgggcactatccccccacctaacctgcctgtgtccatggcgaac
cctctacatcctaacctgccggcgaccaccaccatgccatcttccttgcctctcgggccg
gggctcggatccgccgcagcccagagccctgccattgtggcagctgttcagggcaacctc
ctgcccagtgccagcccactgccagacccaggcaccccgctgcctccagaccccacagct
ccaagcccaggcacagtcacccctgtgccacctccacagtga

DBGET integrated database retrieval system