KEGG   Mus musculus (mouse): 68316Help
Entry
68316             CDS       T01002                                 

Gene name
Apoo, 0610008C08Rik, 1110019O03Rik
Definition
(RefSeq) apolipoprotein O
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X
AA seq 198 aa AA seqDB search
MFKVIQRSVGPASLSLLTFRVYAAPKKDSPHKSYMKIDELSLYSVPEGQSKYVEEPRTQL
EENISQLRHHCEPYTSFCQEIYSHTKPKVDHFVQWGVDNYNYLQNAPPGFFPRLGVIGFA
GFVGLLFARGSKIKKLVYPPFFMGLGASVYYPQQAITIAQITGEKLYDWGLRGYIVIEDL
WKQNFQKPGNVKNSPGNK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaggtaattcagagatctgtggggccagccagcctgagcctgctcaccttcaga
gtctatgcagcacccaaaaaggactcgcctcacaaaagttacatgaagatcgatgagctt
tcactctactcagttcctgagggtcaatctaaatatgtggaggagccaaggactcaactt
gaagaaaacatctcacaactccgacatcattgtgagccatatacaagtttctgtcaggaa
atatactcccatactaaacccaaggtggatcactttgtccagtggggagtagacaactat
aactatcttcaaaatgcgcctcctggatttttcccaagactcggtgttattggttttgct
ggttttgttggactcctttttgctagaggttcaaaaataaagaagctggtgtatcctcct
tttttcatgggattaggtgcctctgtctattacccacaacaagccatcaccattgcccag
atcactggggagaagttatatgactggggattacgagggtacatagttatagaagatttg
tggaagcaaaattttcagaagccaggaaatgtgaagaattcacctggaaataaatag

DBGET integrated database retrieval system