KEGG   Mus musculus (mouse): 68396Help
Entry
68396             CDS       T01002                                 

Gene name
Nat8, 0610037O16Rik, CCNAT, Cml4
Definition
(RefSeq) N-acetyltransferase 8 (GCN5-related)
  KO
K20838  
N-acetyltransferase 8 [EC:2.3.1.80 2.3.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    68396 (Nat8)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.80  cysteine-S-conjugate N-acetyltransferase
     68396 (Nat8)
    2.3.1.-  
     68396 (Nat8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6; 6 C3
AA seq 227 aa AA seqDB search
MASFRIRQFQERDYKQVVDVFSRGMEEHIPTAFRHLLTLPRTLLLLAVVPLAIVLVSGSW
FLAVVCIFFLFLFLWFLASKPWKNYVSKCLHTDMADITKSYLSVRGSGFWVAESGGQVVG
TVAARPVKDPPLGRKQLQLFRLSVSSQHRGQGIAKALTRTVLQFARDQGYSDVVLVTGLL
QQGAVTLYYSMGFQKTGESFVDILTWLVDVSLIHFIYPLPSAQKYEL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttttcgcatccgccagttccaggagagggactacaaacaggtcgtggatgtg
ttctccaggggcatggaggagcacatacccactgccttccgccacttgctgacactgccc
cgaaccctcctgctcttagctgtggtgccccttgccatagtcctggtgtctggctcctgg
ttcctggctgttgtatgcattttctttctgttcctattcttgtggttcctcgccagcaag
ccctggaagaattatgtgtccaaatgtttacacacagacatggctgacatcaccaagtcc
tacctgagtgtccgtggctcaggtttctgggtggctgagtctggggggcaggtggtgggt
acagtggctgctcggccagtcaaggatcctccgttagggaggaagcagctgcagctcttt
cgcctgtctgtgtcctcacagcatcgaggacaggggatagcgaaagcgctgaccagaact
gtcctccagtttgcaagggaccagggttacagtgatgttgtccttgtgactggccttttg
cagcaaggtgctgtgactctctactacagcatgggcttccagaagacaggtgaatccttc
gtggacatactcacatggcttgtggatgtttctctaattcatttcatatacccactccct
tctgctcaaaaatatgagttgtga

DBGET integrated database retrieval system