KEGG   Mus musculus (mouse): 68585Help
Entry
68585             CDS       T01002                                 

Gene name
Rtn4, 1110020G17Rik, AA407876, AA409940, AA960376, ASY, C130026I10Rik, NOGO, NSP-CL, NgA, Nogo-A, Nogo-B, Nogo-C, mKIAA0886, mKIAA4153
Definition
(RefSeq) reticulon 4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11; 11 A3.3
AA seq 1162 aa AA seqDB search
MEDIDQSSLVSSSADSPPRPPPAFKYQFVTEPEDEEDEEDEEEEEDDEDLEELEVLERKP
AAGLSAAPVPPAAAPLLDFSSDSVPPAPRGPLPAAPPTAPERQPSWERSPAASAPSLPPA
AAVLPSKLPEDDEPPARPPAPAGASPLAEPAAPPSTPAAPKRRGSGSVDETLFALPAASE
PVIPSSAEKIMDLKEQPGNTVSSGQEDFPSVLFETAASLPSLSPLSTVSFKEHGYLGNLS
AVASTEGTIEETLNEASRELPERATNPFVNRESAEFSVLEYSEMGSSFNGSPKGESAMLV
ENTKEEVIVRSKDKEDLVCSAALHNPQESPATLTKVVKEDGVMSPEKTMDIFNEMKMSVV
APVREEYADFKPFEQAWEVKDTYEGSRDVLAARANMESKVDKKCFEDSLEQKGHGKDSES
RNENASFPRTPELVKDGSRAYITCDSFSSATESTAANIFPVLEDHTSENKTDEKKIEERK
AQIITEKTSPKTSNPFLVAIHDSEADYVTTDNLSKVTEAVVATMPEGLTPDLVQEACESE
LNEATGTKIAYETKVDLVQTSEAIQESIYPTAQLCPSFEEAEATPSPVLPDIVMEAPLNS
LLPSTGASVAQPSASPLEVPSPVSYDGIKLEPENPPPYEEAMSVALKTSDSKEEIKEPES
FNAAAQEAEAPYISIACDLIKETKLSTEPSPEFSNYSEIAKFEKSVPDHCELVDDSSPES
EPVDLFSDDSIPEVPQTQEEAVMLMKESLTEVSETVTQHKHKERLSASPQEVGKPYLESF
QPNLHITKDAASNEIPTLTKKETISLQMEEFNTAIYSNDDLLSSKEDKMKESETFSDSSP
IEIIDEFPTFVSAKDDSPKEYTDLEVSNKSEIANVQSGANSLPCSELPCDLSFKNTYPKD
EAHVSDEFSKSRSSVSKVPLLLPNVSALESQIEMGNIVKPKVLTKEAEEKLPSDTEKEDR
SLTAVLSAELNKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSV
TISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLF
LVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLAN
KSVKDAMAKIQAKIPGLKRKAE
NT seq 3489 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatagaccagtcgtcgctggtctcctcgtccgcggatagcccgccccggccc
ccgcccgctttcaagtaccagttcgtgacggagcccgaggacgaggaggacgaggaagac
gaggaggaggaggaggacgacgaggacctggaggaattggaggtgctggagaggaagccc
gcagccgggctgtccgcggctccggtgccccccgccgccgcaccgctgctggacttcagc
agcgactcggtgccccccgcgccccgcgggccgctgccggccgcgccccccaccgcccct
gagaggcagccgtcctgggaacgcagccccgcggcgtccgcgccatccctgccgcccgct
gccgcagtcctgccctccaagctcccggaggacgacgagcctccagcgcggcctccggcg
ccagccggcgcgagccccctagcggagcccgccgcgcccccttccacgccggccgcgccc
aagcgcaggggctcgggctcagtggatgagaccctttttgctcttcctgctgcatctgag
cctgtgataccctcctctgcagaaaaaattatggatttgaaggagcagccaggtaacact
gtttcgtctggtcaagaggatttcccatctgtcctgtttgaaactgctgcctctcttcct
tctctatctcctctctcaactgtttcttttaaagaacacggataccttggtaacttatca
gcagtggcatccacagaaggaactattgaagaaactttaaatgaagcttctagagaattg
ccagagagggcaacaaatccatttgtaaatagagagtcagcagagttttcagtattagaa
tactcagaaatgggatcatctttcaatggctccccaaaaggagagtcagccatgttagta
gaaaacactaaggaagaagtaattgtgaggagtaaagacaaagaggatttagtttgtagt
gcagcccttcataatccacaagagtcacctgcgacccttactaaagtggttaaagaagac
ggagttatgtctccagaaaagacaatggacatttttaatgaaatgaaaatgtcagtggta
gcacctgtgagggaagagtatgcagattttaagccatttgaacaagcatgggaagtgaaa
gatacttatgagggaagtagggatgtgctggctgctagagctaatatggaaagtaaagtg
gacaaaaaatgctttgaagatagcctggagcaaaaaggtcatgggaaggatagtgaaagc
agaaatgagaatgcttctttccccaggaccccagaacttgtgaaggacggctccagagcg
tacatcacctgtgattcctttagctcagcaaccgagagtactgcagcaaacattttccct
gtgctagaagatcacacttcagaaaacaaaacagatgaaaaaaaaatagaagaaaggaag
gcccaaattataacagagaagactagccccaaaacgtcaaatcctttccttgtagcaata
catgattctgaggcagattatgtcacaacagataatttatcaaaggtgactgaggcagta
gtggcaaccatgcctgaaggtctaacgccagatttagttcaggaagcatgtgaaagtgaa
ctgaacgaagccacaggtacaaagattgcttatgaaacaaaagtggacttggtccagaca
tcagaagctatacaagagtcaatttaccccacagcacagctttgcccatcatttgaggaa
gctgaagcaactccgtcaccagttttgcctgatattgttatggaagcgccattaaattct
ctccttccaagcactggtgcttctgtagcgcagcccagtgcatccccactagaagtaccg
tctccagttagttatgacggtataaagcttgagcctgaaaatcccccaccatatgaagaa
gccatgagtgtagcactaaaaacatcggactcaaaggaagaaattaaagagcctgaaagt
tttaatgcagctgctcaggaagcagaagctccttatatatccattgcatgtgatttaatt
aaagaaacaaagctctccactgagccaagtccagagttctctaattattcagaaatagca
aaatttgagaagtcggtgcctgatcactgtgagctcgtggatgattcctcacccgaatct
gaaccagttgacttatttagtgatgattcaattcctgaagtcccacaaacacaagaggag
gctgtgatgctaatgaaggagagtctcactgaagtgtctgagacagtaacacaacacaaa
cataaggagagacttagtgcttcacctcaggaggtaggaaagccatatttagagtctttt
cagcccaatttacatattacaaaagatgctgcatctaatgaaattccaacattgaccaaa
aaggagacaatttctttgcaaatggaagagtttaatactgcaatttattccaatgatgac
ttactttcttctaaggaagacaaaatgaaagaaagtgaaacattttccgattcatctccc
attgagataatagatgagtttcccacatttgtcagtgctaaagatgattctcctaaggag
tacactgacctagaagtatccaacaaaagtgaaattgctaatgtccagagcggggccaat
tcgttgccttgctcagaattgccctgtgacctttctttcaagaatacatatcctaaagat
gaagcacatgtctcagatgaattctccaaaagtaggtccagtgtatctaaggtgccctta
ttgcttccaaatgtttctgctttggaatctcaaatagaaatgggcaacatagttaaaccc
aaagtacttacgaaagaagcagaggaaaaacttccttctgatacagagaaagaggacaga
tccctgacagctgtattgtcagcagagctgaataaaacttcagttgttgacctcctgtac
tggagagacattaagaagactggagtggtgtttggtgccagcttattcctgctgctgtct
ctgacagtgttcagcattgtcagtgtaacggcctacattgccttggccctgctctctgtg
actatcagctttaggatatataagggtgtgatccaagctatccagaaatcagatgaaggc
cacccattcagggcatatttggaatctgaagttgccatatcagaggaattggttcagaaa
tatagtaattctgctcttggtcatgtgaacagcacaataaaagaattgaggcgtctcttc
ttagttgatgatttagttgattccctgaagtttgcagtgttgatgtgggtatttacttac
gttggtgccttgttcaatggtttgacactactgattttagctctgatctcactcttcagt
attcctgttatatatgaacggcatcaggcgcagatagatcattatctaggacttgcaaac
aagagcgttaaggatgccatggccaaaatccaagcaaaaatccctggattgaagcgcaaa
gcagaatga

DBGET integrated database retrieval system