KEGG   Mus musculus (mouse): 68667Help
Entry
68667             CDS       T01002                                 

Gene name
Trpm4, 1110030C19Rik, AW047689, LTRPC4, LTrpC-4, TRPM4B
Definition
(RefSeq) transient receptor potential cation channel, subfamily M, member 4
  KO
K04979  
transient receptor potential cation channel subfamily M member 4
Organism
mmu  Mus musculus (mouse)
Pathway
Insulin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    68667 (Trpm4)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   68667 (Trpm4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 B4
AA seq 1213 aa AA seqDB search
MVGPEKEQSWIPKIFRKKVCTTFIVDLSDDAGGTLCQCGQPRDAHPSVAVEDAFGAAVVT
EWNSDEHTTEKPTDAYGDLDFTYSGRKHSNFLRLSDRTDPATVYSLVTRSWGFRAPNLVV
SVLGGSGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQTASTG
SSKVVAMGVAPWGVVRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGT
YGRLGGENRFRLRFESYVAQQKTGVGGTGIDIPVLLLLIDGDEKMLKRIEDATQAQLPCL
LVAGSGGAADCLVETLEDTLAPGSGGLRRGEARDRIRRYFPKGDPEVLQAQVERIMTRKE
LLTVYSSEDGSEEFETIVLRALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRGDIQ
WRSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLYSAVSPNSLIRNLLDQ
ASHASSSKSPPVNGTVELRPPNVGQVLRTLLGETCAPRYPARNTRDSYLGQDHRENDSLL
MDWANKQPSTDASFEQAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASALGACLLLRVMA
RLESEAEEAARRKDLAATFESMSVDLFGECYHNSEERAARLLLRRCPLWGEATCLQLAMQ
ADARAFFAQDGVQSLLTQKWWGEMDSTTPIWALLLAFFCPPLIYTNLIVFRKSEEEPTQK
DLDFDMDSSINGAGPPGTVEPSAKVALERRQRRRPGRALCCGKFSKRWSDFWGAPVTAFL
GNVVSYLLFLLLFAHVLLVDFQPTKPSVSELLLYFWAFTLLCEELRQGLGGGWGSLASGG
RGPDRAPLRHRLHLYLSDTWNQCDLLALTCFLLGVGCRLTPGLFDLGRTVLCLDFMIFTL
RLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLPSILR
RVFYRPYLQIFGQIPQEEMDVALMIPGNCSMERGSWAHPEGPVAGSCVSQYANWLVVLLL
IVFLLVANILLLNLLIAMFSYTFSKVHGNSDLYWKAQRYSLIREFHSRPALAPPLIIISH
VRLLIKWLRRCRRCRRANLPASPVFEHFRVCLSKEAERKLLTWESVHKENFLLAQARDKR
DSDSERLKRTSQKVDTALKQLGQIREYDRRLRGLEREVQHCSRVLTWMAEALSHSALLPP
GAPPPPSPTGSKD
NT seq 3642 nt NT seq  +upstreamnt  +downstreamnt
atggtggggccggagaaggagcagagctggatccctaagatcttcaggaagaaggtgtgc
acgacgttcatagtggacctctccgatgatgcgggagggaccttgtgccagtgtgggcaa
cctcgggatgcccacccttctgtggctgtggaggatgcctttggggcagccgtagttacc
gagtggaacagtgatgagcacaccacggagaagcccacagatgcctatggggacctggac
ttcacgtactctggccgaaagcacagcaactttctccggctgtctgaccgcacggatccg
gccactgtgtacagtctcgttacccgctcttggggctttcgtgccccaaacttggtggtg
tcggtgctgggggggtcggggggccccgtgctccagacctggctgcaggaccttctgcgt
cgcgggctggtgagagccgcccagagcacaggggcctggatcgtcactgggggactgcac
acaggcattggccggcacgtgggtgtggctgtaagggaccaccagacagccagcactggg
agcagcaaggtggtggccatgggtgtggccccctggggagtggtccggaacagagacatg
ctgatcaaccccaagggctcattccccgcaaggtaccggtggcgtggtgaccctgaggat
ggtgttgagttccccctggactataactattctgctttcttcttggtggatgatggcacc
tatggccgcctgggtggtgagaaccgcttccgccttcggtttgagtcctatgtggctcag
cagaagaccggagtgggagggactggaattgacatcccagtgctccttcttctcatcgat
ggagatgagaagatgttaaagcggatagaggatgccacccaagctcagctcccctgcctc
ttggtggcgggctctgggggtgctgcagactgtctggtggagaccctggaagatactctg
gccccagggagtgggggacttaggcgaggcgaagcccgggatcggattaggcgatacttc
cctaaaggagaccctgaggttcttcaggcccaggtagagaggatcatgacccgaaaggag
ttgctgacggtctattcatcagaagacggctccgaggagtttgagactatcgttttgagg
gctcttgtgaaagcctgtgggagctctgaggcctcagcctacctggatgagctgcgtttg
gctgtggcttggaaccgcgtggacatcgcccaaagtgaacttttccgtggggacatccaa
tggcggtccttccacctggaggcatctctcatggatgctctgctgaatgaccggcctgaa
tttgtgcgcctgctcatctcccatggccttagcctgggacacttcctgacccccgtgcgt
ctggcccagctgtacagcgcggtgtcccctaactcactgatccgaaatcttctggaccag
gcgtcccatgctagtagcagcaaatcccctcctgtaaatggaactgtagagctccggcct
cccaatgtggggcaagtgctgaggactctgttgggagaaacgtgtgcaccacggtaccct
gccaggaacacccgagactcctatctgggccaggaccacagagagaatgactctctgctt
atggactgggccaacaagcaaccatcaacggatgcaagctttgaacaagccccctggagt
gacctgcttatttgggctctgttgctgaaccgggcccagatggctatctatttctgggag
aagggctccaactcagtggcctctgctcttggggcttgtcttttactccgagtgatggct
cgcctagagtcggaggctgaggaggccgcgcggcggaaggatcttgctgccacgtttgaa
agcatgagcgtggacctctttggagagtgttaccacaacagtgaagagcgagcagcccgc
cttcttctgcgccgctgtcccctctggggagaggccacctgcctccagcttgccatgcag
gctgatgcccgagcgttctttgcccaggatggagtccagtctcttctgacacagaagtgg
tggggggagatggacagcacaactcccatctgggccctgcttctcgccttcttctgcccg
cctctcatctacaccaaccttatcgtcttcaggaagtcagaggaggagcccacacagaag
gatcttgactttgatatggacagcagcatcaatggagcaggtcctcctgggactgtagaa
ccctctgcaaaggtggcccttgagaggcggcagcggcgacggccaggacgtgccctctgc
tgtggcaagttctccaagcgctggtcggacttctggggtgccccagtgactgccttcctg
ggtaatgtggtcagttacctgctgttcctgctgctgtttgcccacgtgttgctggtggat
ttccagcccacaaagccaagtgtctccgagctgctgctgtacttctgggccttcacgttg
ctgtgcgaggagctgcgccagggcctgggtggtggctggggtagcctggccagtggggga
cgtggtccggacagagctcccctgcgccatcggctgcacctctacctctcagatacctgg
aaccaatgtgacctgctggcactcacctgcttcctgctgggcgtaggctgccggctgacc
cctgggctctttgacttgggacgcaccgtcctctgccttgacttcatgatcttcacactg
cgcctgctgcacatcttcacggtgaacaagcagctggggcccaagattgtcatagtgagc
aaaatgatgaaggatgtattcttcttcctcttcttcctctgcgtgtggcttgtagcttat
ggggtggccacagaggggatcctgaggccccaggaccgcagtctaccgagtatcctgcgc
agggtcttctaccgaccgtatctgcagatcttcggacaaattccccaggaggaaatggac
gtggccctcatgattccaggtaactgctcaatggagcggggctcctgggctcatccggag
gggcccgtcgcaggctcctgtgtgtcccagtatgccaactggctggtggtgttgctcctt
atcgtcttcttgctggtggccaatatcctgttgctcaacctgctcatcgccatgttcagc
tacaccttcagcaaagtgcacggcaacagcgacctctactggaaggcacagcgctacagc
ctcatccgggaattccattcgaggcctgccctggccccacccctcatcatcatctctcat
gtgcgcctcctcatcaagtggctgcgcaggtgtcgcaggtgtcgcagggctaacttgccc
gcctccccagtcttcgagcacttccgtgtctgtctctctaaggaagcagagcggaagctg
ctgacttgggagtctgtgcacaaagagaacttcctgttggcacaagctcgggacaagcga
gacagtgactcggagcgtttgaaacgcacgtctcagaaggtggacactgcactgaagcag
ctgggacagatcagagagtacgatcggcgtctgagggggctggagagagaggtccaacac
tgttctcgagtcctgacttggatggctgaggcccttagccactctgccttgctgcctcca
ggggccccaccccctccgagccccactggttccaaagactga

DBGET integrated database retrieval system