KEGG   Mus musculus (mouse): 68682Help
Entry
68682             CDS       T01002                                 

Gene name
Slc44a2, 1110028E10Rik, CTL2
Definition
(RefSeq) solute carrier family 44, member 2
  KO
K15377  
solute carrier family 44 (choline transporter-like protein), member 2/4/5
Organism
mmu  Mus musculus (mouse)
Pathway
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    68682 (Slc44a2)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC44: Choline-like transporter
   68682 (Slc44a2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   68682 (Slc44a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9; 9 A3
AA seq 706 aa AA seqDB search
MGKDSQNYYGKHGTPQKYDPTFKGPIYNRGCTDVICCVLLFLAIVGYVAVGIIAWTHGDP
RKVIYPTDSRGEFCGQKGTKNADKPFLFYFNIVKCANPLVLLEFHCPTPQICVKQCPDRY
LTLLSARNTRDFDYYKQFCVPGFQNNKGVTEILRDGECPAVITPSKPLAQRCFPAIHASK
GVLMVGNETTYEDGHGARKNITDLVEGAKKANKILEARQLAMQIFEDYTVSWYWIIIGLV
IAMVLSLLFIVLLRFLAGIMVWVMIVMVILVLGYGIFHCYMEYSRLRGEAGSDVSLVDLG
FQTDLRVYLHLRQTWMAFMIILSILEVVIILLLIFLRKRILIAIALIKEASRAVGHVMCS
LLYPLVTFFLLCLCIAYWASTSVFLSTSNTAVYKVVDDTACPLLRKTCNPETFPLRNESL
QCPTARCQFAFYGGESTYHRALLGLQIFNAFMFFWLANFVLALGQVTLAGAFASYYWAMR
KPDDMPAFPLFSAFGRALRYHTGSLAFGSLILAIVQIIRVMLEYLDQRLKAAQNKFAKFL
MVCLKCCFWCLEKFIKFLNRNAYIMIAIYGTNFCTSARNAFFLLMRNIIRVAVLDKVTDF
LFLLGKLLIVGSVGILAFFFFTHRIRIVQDTAPPLNYYWVPILTVIIGSYLIAHGFFSVY
GMCVDTLFLCFLEDLERNDGSAERPYFMSSTLKKLLNKTNKKVAES
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggattcgcagaattactacgggaagcacgggacgcctcagaaatacgacccc
accttcaaaggacccatttacaacaggggatgcacagatgtcatttgctgtgtgttgctc
ttcctggccatcgtaggctatgtggctgtgggcatcatagcctggacccatggagaccct
cggaaggtgatctaccccactgatagccggggcgaattctgtgggcaaaaggggacaaaa
aatgcggacaaaccgttcttgttttacttcaacatcgtgaagtgtgccaaccccctggtc
ctgctggaatttcactgtcccacccctcagatctgcgtgaagcagtgtccagaccgctat
ctcacccttctgagtgcgcgcaacactcgcgactttgactattacaagcagttctgtgtg
cctggcttccagaacaataaaggggtgactgagatactccgagatggggagtgtccagcg
gttatcacccccagcaaacctttggcccagcggtgctttcccgccatccatgccagcaaa
ggagtcctcatggtgggcaatgagacgacctatgaggacggacatggcgccagaaagaac
attacagatctagtggagggtgccaaaaaggccaacaagattctagaggcccggcaactc
gccatgcagatatttgaagattacactgtatcctggtactggattatcataggtctggtc
attgccatggtgctgagtctcctgttcatcgtcctgctgcgattcctggctggcattatg
gtctgggtgatgattgtcatggtgatcctggtgcttggctatggcatcttccactgctac
atggagtactcgagactccgtggagaggcaggctccgacgtctccctggtggaccttggc
ttccagacggacctccgagtgtacctgcacttgaggcagacctggatggcttttatgatc
attttaagcatcctggaagtggtcatcatcctgttacttatctttctgcgcaaaaggata
ttgatcgccatcgccctcatcaaagaagccagcagggctgtgggacatgtcatgtgctcc
ctgctctacccactggtgaccttcttcctcttgtgtctctgcattgcctactgggccagc
acttctgtattcctgtccacctccaacaccgccgtgtacaaggttgttgatgacacagcc
tgcccacttctgaggaaaacctgcaacccagagaccttccccttgcggaatgagagcctc
cagtgtcccactgcccgctgccagtttgccttctatggtggcgaatcgacctaccaccgt
gccctgctgggcctgcagatcttcaatgcattcatgttcttctggctagccaacttcgtg
ctggccctaggccaggtaaccctggccggagcctttgcctcctattactgggctatgcgg
aagcctgatgatatgcctgccttccccctcttctctgcttttggccgagcactcaggtac
cacacgggctccttagcttttggctcccttatcttagccatcgtgcagatcatccgagtg
atgctggaatacctggaccagcgcctaaaagctgcacagaacaagtttgccaagttcctc
atggtctgtctcaagtgctgcttctggtgcctagagaagtttatcaaattcctgaatagg
aatgcctacatcatgattgctatctatggcaccaacttctgtacctcagccaggaatgcc
ttcttcctgcttatgagaaatatcatcagggtggccgtcctggacaaagttacagacttc
ctcttcctgttgggcaaacttctgattgtgggtagtgtgggcatcctggccttcttcttc
ttcacccatcggatcagaattgtgcaagatacagccccacctctcaattattactgggtt
ccgatcctgacagtgatcattggctcctacttgatcgcgcacggcttcttcagcgtctat
ggcatgtgcgtggacacgctgttcctctgtttcttggaggatctggagagaaatgacggt
tcagccgagaggccttacttcatgtcttccactctcaagaaactcttgaataaaaccaac
aagaaagtagcagaatcctaa

DBGET integrated database retrieval system