KEGG   Mus musculus (mouse): 68738Help
Entry
68738             CDS       T01002                                 

Gene name
Acss1, 1110032O15Rik, AI788978, Acas2, Acas2l, AceCS2
Definition
(RefSeq) acyl-CoA synthetase short-chain family member 1
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00620  Pyruvate metabolism
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    68738 (Acss1)
   00620 Pyruvate metabolism
    68738 (Acss1)
   00640 Propanoate metabolism
    68738 (Acss1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     68738 (Acss1)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   68738 (Acss1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 68738
NCBI-ProteinID: NP_542142
MGI: 1915988
Ensembl: ENSMUSG00000027452
Vega: OTTMUSG00000015731
UniProt: Q99NB1 Q3UJ89 Q69Z91
Position
2; 2 G3
AA seq 682 aa AA seqDB search
MAARSLGSGVGRLLRGLQGRSGQSGWSLSVSRSTATRLPGCVPAAAQPGSYPALSAQAAQ
EPAAFWGPLARDTLVWDTPYHTVWDCDFRTGKIGWFLGGQLNVSVNCLDQHVQKSPETIA
LIWERDEPGTEVRITYRELLETTCRLANTLKRHGVHRGDRVAIYMPVSPLAVAAMLACAR
IGAIHTVVFAGFSAESLAGRINDAKCKAVITFNQGLRGGRVVELKKIVDEAVKSCPTVQH
VLVAHRTDTKVPMGSLDIPLEQEMAKEAPVCTPESMSSEDMLFMLYTSGSTGTPKGLVHT
QAGYLLYAAMTHKLVFDYQPGDVFGCVADIGWITGHSYVVYGPLCNGATTVLFESTPVYP
DAGRYWETVQRLKINQFYGAPTAVRLLLKYGDAWVKKYDRSSLRTLGSVGEPINHEAWEW
LHKVVGDGRCTLVDTWWQTETGGICIAPRPSEDGAEILPGMAMRPFFGIVPVLMDEKGNV
LEGGDVSGALCISQAWPGMARTIYGDHQRFVDAYFRAYPGYYFTGDGAHRTEGGYYQITG
RMDDVINISGHRLGTAEIEDAMADHPAVPETAVIGYPHDIKGEAAFAFIVLKDNISDENM
VVNELKLSVATKIAKYAVPDQILVVKRLPKTRSGKVMRRLLRKIITSRGQDLGDTTTLED
PSVITEILSAFQKYEEQRAATN
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcgcagcctcggcagcggtgtggggcgactgctgcgtggcctgcaagggcgc
tctggacaatcggggtggtcactgagcgtgtcccgctcgaccgccacccgactcccgggc
tgcgttcctgcagcagcgcaaccaggctcgtaccccgcgttgagcgctcaggcagcccag
gagccggccgccttctgggggccgctggcccgtgacacactagtttgggacactccttac
catactgtctgggactgtgacttcaggacgggcaagatcggctggttcctgggaggccag
ttgaatgtgtctgtcaactgcctggatcagcatgtgcagaagtctcctgagaccatagct
ttgatctgggagagagatgaacctgggacagaagtgagaatcacttacagggagcttctg
gagaccacatgccgcctggccaatacactgaagagacatggagtgcaccgaggggaccgt
gtggccatctacatgcctgtgtccccactggctgtggcagcaatgctggcctgtgccagg
attggagctatccacacagtggtatttgctggctttagtgcagagtccttggctgggagg
atcaatgatgccaaatgcaaggctgttatcaccttcaaccaaggactcaggggagggcgt
gtggtggagctgaagaaaatagtggatgaagctgtgaagagctgcccaacagtccagcat
gtcctggtggctcacaggacggacaccaaggttcccatggggagtctggatatccccctt
gaacaggagatggccaaggaggcccctgtttgcacccctgagagcatgagcagtgaagac
atgctctttatgctctacacctcagggagcaccgggacacccaagggactcgttcataca
caggcaggctatctactgtatgccgccatgacgcacaagctcgtgtttgactaccagcca
ggtgatgtctttggctgtgtggctgacatcggttggatcacaggacacagctatgtggtg
tatggacccctctgcaatggagctaccacagtcctttttgagagcaccccagtttaccct
gatgctggtcgttactgggagacagtgcagaggctaaagatcaaccagttctatggtgcc
ccgacagctgtccggctgctgctgaagtatggggatgcctgggtgaaaaagtatgaccgc
tcttccctgcgcacactggggtcagtgggagagcctatcaaccacgaagcctgggagtgg
ctccacaaagtcgtgggtgatggcagatgtacactggtggacacttggtggcaaacggaa
actggaggcatctgcattgcaccacggccctcggaagatggggcagagatcctcccgggc
atggccatgaggccgttttttggcatcgttcctgtactcatggatgagaagggcaatgtt
ttggagggtggagatgtctctggggccttgtgtatttcccaagcttggccaggcatggca
aggaccatctatggtgaccaccagaggttcgtagatgcctacttcagagcgtacccaggt
tattacttcactggagacggagctcaccggacagagggtggctattaccagatcacgggg
cgcatggatgatgtcatcaatatcagtggtcatcgcctggggactgcagagattgaggat
gcaatggctgaccatcccgctgttccagagactgctgtcattgggtaccctcatgatatc
aaaggagaagctgcatttgccttcattgtgctgaaagataacatcagtgatgagaacatg
gtagtgaatgaactcaaattgtcggtggccaccaagatcgccaagtatgctgtgcctgac
cagatcctggtggtgaagcgtctccccaaaaccagatctgggaaagtgatgaggagacta
ctgaggaagatcatcaccagcaggggacaggatctaggggacaccactaccctggaggac
cccagcgtcatcacagaaatcttgagtgccttccagaagtatgaagagcagcgggctgct
accaactga

DBGET integrated database retrieval system