KEGG   Mus musculus (mouse): 68738Help
Entry
68738             CDS       T01002                                 

Gene name
Acss1, 1110032O15Rik, AI788978, Acas2, Acas2l, AceCS2
Definition
acyl-CoA synthetase short-chain family member 1 (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    68738 (Acss1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    68738 (Acss1)
   00620 Pyruvate metabolism
    68738 (Acss1)
   00640 Propanoate metabolism
    68738 (Acss1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     68738 (Acss1)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   68738 (Acss1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 G3; 2
AA seq 682 aa AA seqDB search
MAARSLGSGVGRLLRGLQGRSGQSGWSLSVSRSTATRLPGCVPAAAQPGSYPALSAQAAQ
EPAAFWGPLARDTLVWDTPYHTVWDCDFRTGKIGWFLGGQLNVSVNCLDQHVQKSPETIA
LIWERDEPGTEVRITYRELLETTCRLANTLKRHGVHRGDRVAIYMPVSPLAVAAMLACAR
IGAIHTVVFAGFSAESLAGRINDAKCKAVITFNQGLRGGRVVELKKIVDEAVKSCPTVQH
VLVAHRTDTKVPMGSLDIPLEQEMAKEAPVCTPESMSSEDMLFMLYTSGSTGTPKGLVHT
QAGYLLYAAMTHKLVFDYQPGDVFGCVADIGWITGHSYVVYGPLCNGATTVLFESTPVYP
DAGRYWETVQRLKINQFYGAPTAVRLLLKYGDAWVKKYDRSSLRTLGSVGEPINHEAWEW
LHKVVGDGRCTLVDTWWQTETGGICIAPRPSEDGAEILPGMAMRPFFGIVPVLMDEKGNV
LEGGDVSGALCISQAWPGMARTIYGDHQRFVDAYFRAYPGYYFTGDGAHRTEGGYYQITG
RMDDVINISGHRLGTAEIEDAMADHPAVPETAVIGYPHDIKGEAAFAFIVLKDNISDENM
VVNELKLSVATKIAKYAVPDQILVVKRLPKTRSGKVMRRLLRKIITSRGQDLGDTTTLED
PSVITEILSAFQKYEEQRAATN
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcgcagcctcggcagcggtgtggggcgactgctgcgtggcctgcaagggcgc
tctggacaatcggggtggtcactgagcgtgtcccgctcgaccgccacccgactcccgggc
tgcgttcctgcagcagcgcaaccaggctcgtaccccgcgttgagcgctcaggcagcccag
gagccggccgccttctgggggccgctggcccgtgacacactagtttgggacactccttac
catactgtctgggactgtgacttcaggacgggcaagatcggctggttcctgggaggccag
ttgaatgtgtctgtcaactgcctggatcagcatgtgcagaagtctcctgagaccatagct
ttgatctgggagagagatgaacctgggacagaagtgagaatcacttacagggagcttctg
gagaccacatgccgcctggccaatacactgaagagacatggagtgcaccgaggggaccgt
gtggccatctacatgcctgtgtccccactggctgtggcagcaatgctggcctgtgccagg
attggagctatccacacagtggtatttgctggctttagtgcagagtccttggctgggagg
atcaatgatgccaaatgcaaggctgttatcaccttcaaccaaggactcaggggagggcgt
gtggtggagctgaagaaaatagtggatgaagctgtgaagagctgcccaacagtccagcat
gtcctggtggctcacaggacggacaccaaggttcccatggggagtctggatatccccctt
gaacaggagatggccaaggaggcccctgtttgcacccctgagagcatgagcagtgaagac
atgctctttatgctctacacctcagggagcaccgggacacccaagggactcgttcataca
caggcaggctatctactgtatgccgccatgacgcacaagctcgtgtttgactaccagcca
ggtgatgtctttggctgtgtggctgacatcggttggatcacaggacacagctatgtggtg
tatggacccctctgcaatggagctaccacagtcctttttgagagcaccccagtttaccct
gatgctggtcgttactgggagacagtgcagaggctaaagatcaaccagttctatggtgcc
ccgacagctgtccggctgctgctgaagtatggggatgcctgggtgaaaaagtatgaccgc
tcttccctgcgcacactggggtcagtgggagagcctatcaaccacgaagcctgggagtgg
ctccacaaagtcgtgggtgatggcagatgtacactggtggacacttggtggcaaacggaa
actggaggcatctgcattgcaccacggccctcggaagatggggcagagatcctcccgggc
atggccatgaggccgttttttggcatcgttcctgtactcatggatgagaagggcaatgtt
ttggagggtggagatgtctctggggccttgtgtatttcccaagcttggccaggcatggca
aggaccatctatggtgaccaccagaggttcgtagatgcctacttcagagcgtacccaggt
tattacttcactggagacggagctcaccggacagagggtggctattaccagatcacgggg
cgcatggatgatgtcatcaatatcagtggtcatcgcctggggactgcagagattgaggat
gcaatggctgaccatcccgctgttccagagactgctgtcattgggtaccctcatgatatc
aaaggagaagctgcatttgccttcattgtgctgaaagataacatcagtgatgagaacatg
gtagtgaatgaactcaaattgtcggtggccaccaagatcgccaagtatgctgtgcctgac
cagatcctggtggtgaagcgtctccccaaaaccagatctgggaaagtgatgaggagacta
ctgaggaagatcatcaccagcaggggacaggatctaggggacaccactaccctggaggac
cccagcgtcatcacagaaatcttgagtgccttccagaagtatgaagagcagcgggctgct
accaactga

DBGET integrated database retrieval system