KEGG   Mus musculus (mouse): 68794Help
Entry
68794             CDS       T01002                                 

Gene name
Flnc, 1110055E19Rik, ABP-280, ABPL, Fln2
Definition
filamin C, gamma
Orthology
K04437  
filamin
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    68794 (Flnc)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    68794 (Flnc)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    68794 (Flnc)
  Infectious diseases
   05132 Salmonella infection
    68794 (Flnc)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   68794 (Flnc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 A3.3; 6 12.36 cM
AA seq 2726 aa AA seqDB search
MMNNSNYSDASGLGLVDEADEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVQNAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFT
VQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RRDTVEVALEDKGDNTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYP
VVPGKYVVTITWGGYAIPRSPFEVQVSPEAGAQKVRAWGPGLETGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAPPDCFPDKVKAFGPGLEPTGCIVDRPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVI
PNGDGTFRCSYVPTKPIKHTIIVSWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPVEADIDFDIIKNDNDTFTVKYTPPGAG
HYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLSRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVN
VAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGG
GAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGT
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIQPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIQNNADGTYHITYSPAFPGTYTITIKYGGHPIPKFPTRVHVQPAVDTSGIKVSGPG
VEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGQPIPGSPFRVPVKD
VVDPGKVKCSGPGLGTGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDG
THTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPSHDASKVRASGPGLNASGIPASLP
VEFTIDARDAGQGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD
EIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVT
CTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLP
HVEEPAEMLQMRQPYAPLRPGTCPTHWATEEPVVPVEPLESMLRPFNLVIPFTVQKGELT
GEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINS
RHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYL
PTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITEGDLSQLTA
SIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIG
DASKVRVWGKGLSEGQTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVT
YCPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLK
IPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFP
AVFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKTEAAEIVEGEDSAYSVRFV
PQEMGPHTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWT
REAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVV
PVASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSEL
DSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGT
TGVSSEFIVNTQNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGG
PQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGASYSSIPKFSSDASKVV
TRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVK
EKGDYILIVKWGDESVPGSPFKVNVP
NT seq 8181 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaacagcaactattcggacgcctccggcctcggcctggttgacgaggcggac
gagatgccgtccacggagaaggacctagcggaggacgcaccgtggaagaagatccagcag
aacacattcacgcggtggtgcaacgagcatctcaagtgtgtgggcaagcgcctgaccgac
ctgcagcgagacctcagcgacgggctgcgcctcatcgcgctgctcgaagtgctcagccag
aagcgcatgtaccgcaagttccacccgcgccccaacttccgccaaatgaagctggaaaat
gtgtctgtggccctggagttcctggagcgggaacacatcaagctcgtgtccatcgacagc
aaggctattgtggatggaaacctgaagctgatcctaggcctgatctggacgctgatcctt
cactactccatttccatgcccatgtgggaggatgaagatgatgaggatgcccgcaaacag
acacccaagcagcgactgcttggctggatccagaacaaagtgccccagctgcccatcacc
aactttaaccgagactggcaggacggcaaggctctgggtgccctggttgacaactgtgcc
cctggtctctgccctgattgggaagcctgggaccccaaccagcccgtgcagaatgccaga
gaggccatgcagcaagctgatgactggctcggggtgccccaggtgattgctcctgaagaa
atcgtggatcccaatgtggatgaacactctgtcatgacctacctgtcccagtttcccaag
gccaagctcaaacccggtgcccctgttcgctctaagcagctgaatcctaagaaagccatt
gcctatgggcctggcattgagccccaggggaacactgtgctgcagcctgcccacttcacc
gtgcagacagtagatgctggtgtaggggaggtgctggtctacattgaggaccccgaggga
cacacggaggaggccaaagtggttcccaacaatgacaaagaccgcacctatgccgtctcc
tatgtgcccaaggttgctgggttacacaaggtgaccgtgctctttgctggccagaacatc
gagcgtagtccctttgaggtgaatgtgggcatggctctcggggatgccaacaaggtatca
gcccgtggccctggtctggaacctgtgggtaacgtggccaacaaacccacctactttgac
atctatactgccggggctggcactggtgatgttgctgtggtgatcgtggacccacaggga
cgtcgggatacagtcgaggtggccctggaggacaagggtgacaacacgttccgctgcacg
tacaggcccgtgatggaggggccacacaccgtgcatgtggcctttgctggtgcacccatc
acccggagtcctttccctgtccatgtggcagaagcctgtaaccccaacgcctgcagagcc
tctgggcggggcctgcagcccaaaggtgtgcgtgtgaaagaggtggctgacttcaaggtg
ttcaccaagggtgctggcagcggggaactcaaggtcaccgtcaaaggtccaaagggcaca
gaggagccagtgaaagttcgggaggctggagatggggtgttcgagtgcgagtactaccca
gtggtacctgggaagtatgtggtgaccatcacctggggtggctatgccattccccgcagt
ccttttgaggttcaggtgagcccagaggccggagcccagaaagtgcgggcatggggtcct
gggttggagactggccaggtgggcaagtcggctgacttcgtggtggaagccatcggtaca
gaagtgggaacgctgggcttctccatcgaggggccctcacaagccaagattgaatgtgat
gacaaaggtgacggctcctgtgacgtgcggtactggcccacggagcctggggagtatgct
gtgcatgtcatctgcgatgatgaagacatccgggactcgcctttcatcgcccacatccag
ccagccccaccagactgcttcccagacaaggtgaaagcatttggacctggcctggagccc
actggctgcatagtggacaggcctgccgagttcaccattgatgcccgtgctgctggcaag
ggagatttgaagctctatgcccaggatgcagatggctgccccatcgacatcaaggtgatc
cccaacggtgacggtaccttccgctgctcctacgtgcctaccaaacccatcaagcacact
atcatcgtctcctggggaggtgtcaacgtgcctaagagccccttcagggtgaatgtggga
gaaggcagccatcctgagcgggtgaaggtatatggccctggagtagagaagacaggcctt
aaagccaatgaacccacctatttcacagtggactgcagtgaagccgggcaaggtgatgtg
agtattggcatcaagtgtgctccaggcgtggtggggcctgtggaagctgacatcgacttt
gacatcatcaagaatgacaacgataccttcacagtcaagtacacaccccccggggccggc
cactacacgatcatggtgttgtttgccaaccaggagatccctgccagtcccttccacatc
aaggtggacccatcccatgacgctagcaaggtcaaggctgagggtcctgggctgagccgc
acaggtgtggaagtcggaaagccgactcactttaccgtgctgaccaagggagctggcaag
gctaagctggacgtgcactttgctggggcagccaagggcgaggctgtgcgggactttgaa
atcattgacaaccatgactattcatacactgtcaagtacacagctgtgcagcagggcaac
atggcagtaacagtgacctacggtggggaccctgtccccaaaagtccctttgtggtgaat
gtggcacccccactggacctcagcaaagtcaaagttcaaggcctcaacagcaaggtagct
gtgggacaggaacaggcgttctcggtgaacaccagaggggctggtggtcagggacaactc
gatgtgcggatgacctcaccctcccgacggcctatcccctgcaagctggagcctgggggt
ggagcagaagcccaggctgtccgctacatgccccctgaagagggaccttacaaggtggac
atcacctacgatggtcacccagtgcctggcagcccctttgctgtggaaggtgtcctgccc
cctgacccctctaaggtctgcgcgtatggccctggtctcaagggcgggcttgtaggcacc
ccggcaccattctccattgacaccaagggggccggcacaggaggcctggggctgactgtc
gagggcccctgcgaagccaagatcgagtgccaagacaatggtgacggatcttgtgcagtc
agctacctgcccacggagccaggcgagtacaccatcaatatcctgtttgctgaagcccac
atccctggctcgcccttcaaggccaccatccagcctgtgttcgacccaagcaaggtgagg
gccagtgggccaggcctggagcgtggcaaggctggagaggcagccaccttcaccgtggac
tgctcagaagcgggtgaggccgagctgaccatcgagatcctgtcggacgctggtgtcaaa
gcggaggtgctgatccaaaacaacgcggacggcacctaccacatcacctacagccctgcc
ttccccggcacctacaccatcaccatcaagtatggcggccaccccatacccaagttcccc
acccgtgtccacgtgcagcctgcagttgataccagtggcatcaaggtctctgggcctggt
gtggagccacatggtgtcctgcgggaggtgaccaccgagtttactgtggatgcgagatct
ctaacagctacaggcggcaaccatgtgacagctcgtgtcctcaacccctccggtgctaag
acagatacctatgtgacagacaacggggatggcacctaccgggtgcagtacactgcctat
gaagagggtgtgcatttggtagaggtgctgtatgacgaagtagctgtgcccaagagcccc
ttccgagtgggtgtgactgagggctgtgaccccacccgagtccgggccttcgggccaggt
ctggaaggtggcttggtgaacaaggccaaccgcttcactgtggaaaccaggggtgctggc
acaggaggccttggcctagccattgagggcccctcagaagctaagatgtcctgcaaggac
aacaaggacggaagctgcaccgtggagtacatcccctttacccctggagactatgatgtc
aacatcacctttgggggacagcccattccaggaagcccattccgagttcctgtgaaggat
gtggtagaccctgggaaggtgaagtgctcagggccagggctagggaccggcgtcagggct
cgagtacctcagaccttcacagtggactgcagtcaagctggccgggcccctctgcaggtg
gccgtgctgggccccacaggtgtggctgagcctgtggaggtgcgtgacaatggcgatggt
acccacactgtccactacacacctgccactgatggtccctatactgtagctgtcaagtat
gctgaccaggaggtgccacgaagccctttcaagatcaaagtgcttccatcccatgatgcc
agcaaagtgcgggccagtggccctggcctcaatgcctcgggcatccctgccagcctgccc
gtggagttcaccattgatgctcgtgatgctgggcaggggcttcttaccgtgcagatcctg
gatcccgagggtaaacccaagaaggccaacatccgagacaatggggatggcacatatact
gtgtcctacctgcccgacatgagtggtcggtacaccatcaccatcaagtacggcggcgat
gagatcccttactcgcccttccgcatccatgccctgcctacaggggatgccagcaagtgc
cttgttacagtgtccattggaggccatggactgggtgcctgcctgggtcccagaatccag
atcggagaggagactgtgatcacagtggacgccaaggcagcaggcaaggggaaggtgacc
tgcacagtatccacacccgatggggcagagctcgatgtggacgtggtcgagaaccatgat
ggcaccttcgacatctactacacagctcccgagccgggcaaatatgtcatcaccatccgc
tttgggggcgaacacatccccaacagccctttccacgtgctggcctgtgacccgctgcct
cacgtggaggagcccgcggaaatgctgcagatgcgccagccctatgcccctcttcggcct
ggcacctgccccacgcactgggccacagaggagcccgtggtgcctgtggagcctctggaa
tccatgctgaggcctttcaacttggtcatccccttcactgtgcagaaaggggagctgaca
ggggaagtccggatgccttctggaaaaacagcgcgccccaacatcactgacaacaaggat
ggaaccatcacagtgagatacgcaccgacagagaagggcctgcaccagatggggatcaag
tacgacggcaaccatatccctgggagccctctgcagttctatgtggatgccatcaacagc
cgccatgtcagtgcctacgggccaggcctgagccatggcatggtcaacaagcctgccacc
ttcacaattgtcaccaaggatgctggggaaggggggctgtcactggctgtggagggccca
tccaaggcggagatcacctgcaaggacaacaaggatggcacctgtacagtgtcctacctg
cccacagcacccggagactacagcatcatcgtgcgctttgacgacaagcacatcccaggg
agccccttcacggccaagatcacaggtgacgactcaatgagaacatcacagcttaatgtg
ggcacctccaccgatgtgtcactgaagatcacggagggtgacctcagccagctgacagcc
agcatccgtgctccttcaggcaatgaagagccatgcctgctgaagcgcctgcccaacagg
cacattgggatctcctttacccccaaggaggtcggtgagcacgtggtgagcgtgcgcaag
agtggcaagcacgtcaccaacagcccctttaagattttggtggggccttcggagatcggg
gatgccagcaaagttcgagtctggggcaaaggcctttccgagggacaaaccttccaagtg
gcagagttcattgtggacactcgcaatgcaggttatggaggcctggggctgagcatcgaa
ggccctagcaaggtggacattaactgtgaggatatggaagacggtacctgcaaagtcacc
tactgcccgactgaacccggcacctacatcatcaatattaagtttgctgacaagcacgta
cctggaagccccttcaccgtgaaggtgactggcgagggacgcatgaaggaaagcatcact
cggcgcagacaggcaccctccattgccaccattggtagcacctgtgacctcaacctcaag
atcccaggaaactggtttcagatggtgtctgcccaggagcgcctgactcgcaccttcacg
cggagcagtcatacgtacacccgcacagagcggacagagatcagcaagactcggggtggg
gagaccaagcgtgaagtccgagtggaggagtccacccaggtcggcggagaccctttccct
gctgttttcggcgattttctaggccgggaacgcctgggctccttcggcagcatcacccgg
cagcaggaaggtgaggccagctctcaggacatgacagcccaggtgacaagtccgtctggc
aagacagaagccgcagagatcgttgagggagaagacagcgcatacagtgtgcgattcgtg
ccccaggagatgggtccccacacagtcactgtcaagtaccgcggccaacacgtgcccgga
agcccttttcagttcactgtgggtccgctaggtgaaggtggtgcccacaaggtgcgagct
ggaggcacagggctggagcgaggtgtagctggtgtgccagctgagtttagcatctggacc
cgagaagctggtgctgggggattgtccatcgctgtggaaggtcccagcaaggcagagatt
gcatttgaggaccgcaaagatggttcttgtggcgtctcctatgttgtccaggagccaggt
gactacgaggtctccatcaagttcaatgatgagcacatcccagacagcccgttcgtggtg
cccgtggcctccctctcagacgacgctcgccgcctcactgttaccagcctccaggagaca
gggcttaaagtgaaccagccagcatctttcgcggtgcagcttaatggggcacgtggtgtg
attgatgcccgggtacacacaccctcaggagctgtggaggagtgctatgtctctgaactg
gacagtgataagcataccatccgcttcatcccccatgagaacggtgtccactcaattgat
gtcaagttcaacggcgcccacatccctggaagtcccttcaagatccgtgttggggagcag
agccaggctggggacccaggcttggtgtcagcttatgggcctgggcttgaaggaggcact
acgggcgtatcatcagagtttattgtgaacacccagaatgcaggctcaggggctttgtct
gtcaccattgatgggccttccaaggtgcagctggactgtcgggaatgtcccgagggccat
gtagtcacttacactcccatggctcctggtaactacctcattgctatcaagtatggtggc
cctcagcacattgtgggcagtcccttcaaagcaaaggtcacaggtccccggttgtctgga
ggccacagccttcacgaaacatccacagttctggtggagacggtgaccaagtcctcctcg
agccgcggtgccagttacagttccatccccaagttctcctcggatgccagcaaggtggta
acaaggggccctggtctgtcccaggcctttgtgggtcagaagaactcattcaccgtggac
tgcagcaaagcaggcaccaacatgatgatggtgggcgtgcatgggcccaagaccccctgc
gaagaggtatatgtgaagcacatgggaaaccgggtctacaacgtcacctacactgtcaag
gagaagggagactacatcctcattgtcaagtggggtgatgaaagtgtccctgggagcccc
ttcaaggtcaatgtgccctga

DBGET integrated database retrieval system