KEGG   Mus musculus (mouse): 69131Help
Entry
69131             CDS       T01002                                 

Gene name
Cdk12, 1810022J16Rik, AI646528, Crk7, Crkrs, D11Ertd752e, Pksc
Definition
(RefSeq) cyclin-dependent kinase 12 (EC:2.7.11.23 2.7.11.22)
  KO
K08819  
cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     69131 (Cdk12)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     69131 (Cdk12)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   69131 (Cdk12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 D; 11 61.75 cM
AA seq 1484 aa AA seqDB search
MPNSERHGGKKDGSGGASGTSQPSSGGGSSNSRERHRLVSKHKRHKSKHSKDVGLVTPEA
ASLGTIIKPLVEYDDISSDSDTFSDDTAFKSDRRENEERRGTDRSDRLHRHRHHQHRRSR
DLLKTKQTEKEKNQEVSKSGSMKDRVSGSSKRSVEGSDDYGKAQLSKSGSKESRSSKMHK
EKTRKERELKSGYKDRSKSHRKRETPKSYKTVASPKRRSRSPHRKWSDSSKQDDSPSGAS
YGQDYDLSPPRSHTSSNYDSYKKSPGSTSRRQSISPPYKEPSAYQSSTRSPSPYSRRQRS
VSPYSRRRSSSYERSGSYSGRSPSPYGRRRSSSPFLSKRSLSRSPLPSRKSMKSRSRSPA
YSRHSSSHSKKKRSGSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAAAAAKMDGKESK
SSPIILPKKEKLEVKESGLESKKLPRSIKSEKSTPDTELVTVAHSNPEVKHCLDTGKVRL
DENLQKHPAKDLKAQGTKDVKPVAPKEVIVTSKETETSEKETLPPLPTITSPPPLPATTP
PPQTPPLPPLPPLPAIPLQPPLPPPQPPFSQVPVSSTSILPSSPHPRTSTLSSQTNSQPP
VQVSMKTQVSITAAIPHLKTSTLPPLPLPPLLPGDDDMDSPKETLPSKPAKKEKEQRTRH
LLTDLPLPPELPGGDPSPPDSPEPKAITPPQQPYKKRPKICCPRYGERRQTESDWGKRCV
DKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLVHQ
SVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLM
EGLDYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPP
ELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVI
KLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVE
LSKMAPPDLPHWQDCHELWSKKRRRQRQSGIVIEDPPPSKASRKETTSGTTAEPVKNNSP
APPQPAPVKAEPGPGDAVGLGDITQQLNQSELAVLLNLLQSQTDLSIPQMAQLLNIHSNP
EMQQQLEALNQSISALTEASSQQQDSESIAPEESLKEVPSVPVVLPPAEQTTPEASNTPA
DMQNVLAVLLSQLMKTQEPAGNLEENTNDKNSGPQGPRRTPTMPQEEAAACPPHILPPEK
RPPEPPGPPPPPPPPPLVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALR
PMEYSTRSHPNRTYGNTDGPETGFSSADTDERSSGPALTESLVQTPVKNRTFSGSVSHLG
ESNSYQGTGSVQFPGDQDLRFTRVPLALHSVVGQPFLKSEGNSNSVVHAETKLQNYGELG
PGTTGANSSGTTLQWGGPAQSYGKPYRGAARVLPRGGRGRGVPY
NT seq 4455 nt NT seq  +upstreamnt  +downstreamnt
atgcccaattccgagagacatgggggcaagaaggacgggagcggaggagcttctggaact
tcgcagccgtcatcgggaggtggcagctccaacagcagggagcgtcaccgcttggtgtcg
aagcacaagcggcataagtccaagcactccaaagacgtggggctggtgacccccgaagcg
gcatctttgggtaccataatcaaaccactggtggagtacgatgacatcagctctgattca
gacaccttctccgatgacacggccttcaaatcagaccggagggagaacgaggaacgtcgg
ggaacggatcggagcgatcgcctgcaccgacatcgtcaccaccagcaccggcggtcccga
gacttgctaaaaactaaacagacggaaaaggaaaaaaatcaggaagtctccaaatctgga
tctatgaaggaccgggtatcgggcagttccaaacggtccgtggaggggagtgatgattat
gggaaggcccagctatccaaaagcggcagcaaggaatccaggtcgtccaaaatgcacaag
gagaagacccgcaaagagcgagagttaaagtctggatacaaggaccggagtaaaagtcat
cggaaaagggaaacacccaaaagttacaaaaccgtggctagccctaaacggagatccagg
agtccccataggaaatggtctgacagttccaagcaagatgacagcccttccggagcttct
tatggccaagactacgatcttagccccccaaggtctcacacttctagcaactatgactcc
tacaagaagagtcctggaagtacctcaagaaggcagtcaatcagcccaccttacaaagag
ccttctgcttaccagtccagcactcggtcacccagtccttacagccgacgacagaggtct
gtgagtccctatagccggagacggtcctccagctatgaaaggagcggctcttacagcggg
agatcacccagcccctatggccgaaggcgatcaagcagccctttcctgagcaagaggtct
ctgagtcggagtccactccccagtaggaaatccatgaagtccagaagtagaagtcctgca
tattcaagacactcatcttctcatagtaaaaagaagcgatccgggtcacgcagtcgtcat
tccagtatctcacctgtcaggcttccattgaattccagcctgggagctgaactcagtaga
aaaaagaaggaaagagcagcagctgctgcagcagcaaaaatggatggaaaagagtccaag
agttcacctataattttgcctaaaaaagagaaacttgaggtgaaggagtcagggttagag
tctaaaaagttacccagaagtataaaatcagaaaaatcgaccccagatactgaactggtt
actgtagcacattcaaacccagaggtaaaacattgtttagacacagggaaggttaggttg
gatgagaacttgcagaagcatcctgctaaggatttgaaagcacagggaacaaaggacgtt
aaacctgtagcaccgaaagaggtgattgttacttcaaaggagacagagacatcagaaaag
gagacccttccacctcttcccacaattacttctccaccccctttaccagctactacccct
ccacctcagacaccccctttgccacctttgcctccactaccagctattccgctgcagcca
cctctgcctcctccccaaccaccatttagtcaagttcctgtttcaagtacttcaatttta
ccctcttctcctcacccaaggacatctactctatcctctcagacaaattctcagccccct
gtacaggtttctatgaagactcaagtatctataacagctgctattccacatctgaagact
tcaacattgcctcctctgcccctccctcccctattacctggagatgatgacatggatagt
ccaaaagaaacacttccttcaaagcctgcaaagaaagagaaggaacagaggactcgccac
ttgcttacagacttgcctcttcctcctgagctaccaggaggagatccatcgcctccagat
tctccagagccaaaggcaattacaccacctcaacaaccatataaaaagagaccaaaaatt
tgttgtccacgttatggagaaagaagacaaacagaaagtgattgggggaagcgctgtgtg
gacaagtttgacattattgggattattggagaggggacctatggccaagtatataaagcc
aaggacaaagacacaggagaactagtagctctgaagaaggttcggctggacaatgagaaa
gagggcttcccaatcacagccatccgggagatcaagattcttcgtcaattagttcaccag
agtgttgtaaacatgaaggaaattgtcacagacaaacaagatgcactggatttcaagaag
gacaaaggtgccttttaccttgtatttgaatatatggaccatgacttaatgggactgctt
gaatcaggtttggtgcacttttctgaggaccatatcaagtcatttatgaaacagctaatg
gaaggactggattactgtcacaaaaagaatttcctccatcgggatattaaatgttctaac
attttgctgaataacagcgggcaaatcaaactggcagattttggacttgctcggctctat
aactctgaagagagtcgcccttacacaaacaaagtcatcactctttggtatcgacctcca
gagcttcttcttggagaggaaagatacacaccagccattgatgtttggagctgtgggtgc
atccttggagaactgttcacaaagaaacctatttttcaagccaatttagaactggctcag
ctagaacttatcagtcgtctctgtggtagtccttgtccagcagtgtggcctgatgttatc
aagctgccctacttcaacaccatgaaaccgaagaagcaatacaggagacgcctaagagaa
gaattctctttcattccttcagcggcacttgatctattggaccacatgctgacactggat
cctagcaagaggtgcacagctgaacagaccctacagagtgactttcttaaagatgtggaa
ctcagcaaaatggcacctccagacctacctcactggcaggattgccatgaattgtggagt
aagaaacgtcgacggcagcgacagagtggtattgtgatagaagatccacctccgtccaaa
gcttctagaaaagaaactacctcagggacaacagctgagcctgtgaaaaacaatagccca
gcaccacctcagcctgctcctgtcaaggcagagcctggtccaggggatgcagtaggcctt
ggtgacatcacacagcagttgaatcaaagtgaattggcagtgttattaaacctgcttcag
agccaaactgacctgagcatccctcagatggcacagctgcttaatatccactccaatcca
gagatgcaacagcagcttgaagccttgaatcagtctattagtgcactgactgaagccagt
tcccagcagcaggactcagaatccatagcccctgaagaatcattgaaggaggtaccttct
gtacctgtggtcctgcctcctgctgaacagacaactcctgaagcttcaaacacaccagct
gacatgcagaatgtgttggcagttctcttgagtcagctgatgaaaacccaagagccagca
ggtaacctggaggaaaacaccaatgacaagaatagtgggccacaggggccccgaagaact
cctacaatgccacaggaggaggcagcagcatgtcctcctcacattcttccaccagagaag
aggccccctgagccccctggacctccaccgccgccacctccaccccctctggttgaaggc
gatctttccagcgccccccaggagttgaatcccgccgtgacagccgccttgctgcaactt
ttatcccagcctgaagcagagcctcctggccacctgccacatgagcaccaggccttgaga
ccaatggaatactccacccgatcccatccaaacaggacttacggaaatactgatgggcct
gagacagggttcagttccgctgacactgatgaacgcagttctggtccagccttgacagaa
tctttggttcagaccccggtgaagaacaggaccttctcaggctctgtgagccaccttggg
gagtccaacagctaccagggcacagggtcagtgcagttcccaggggaccaggacctccgt
tttaccagggttcccttagcattacactcagtggttgggcaaccattcctcaagtctgag
ggaaatagcaactctgtggtacatgcagagaccaaattgcaaaactatggggagctggga
ccgggaaccactggggccaacagctcaggaacaacgcttcagtgggggggcccagctcag
tcttatggaaaaccctacaggggggctgcaagagtcctaccacgagggggaagagggaga
ggagttccttattaa

DBGET integrated database retrieval system