KEGG   Mus musculus (mouse): 69163Help
Entry
69163             CDS       T01002                                 

Gene name
Mrpl44, 1810030E18Rik, 5730593H20Rik, AI463302
Definition
(RefSeq) mitochondrial ribosomal protein L44 (EC:3.1.26.-)
  KO
K17425  
large subunit ribosomal protein L44 [EC:3.1.26.-]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     69163 (Mrpl44)
Ribosome [BR:mmu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    69163 (Mrpl44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 C4
AA seq 333 aa AA seqDB search
MASAVFRLLQQGPRRLLAPAVPTLAPPVRGVKKGFRAAFRFQKELERWRLLRCPPPPVRR
SEKPNWDYHAEVQAFGSRLQETFSLDLLKTAFINSCYIKSEEAKRQSLGIEKEAALLNLK
DNQELFEQGLSFSHRCLTQFLEDEFPDLPAEGTESLVSFLTGEAVVCHVARNLAVEQLTL
SAEFPVPLPVLRQTFFAVIGALLQSSGPERAALFIRDFLITQMTGKELFEMWTVVNPMGL
LVEELKKRNISAPESRLTRQSGSTTALPLYFVGLYCDRKLIAEGPGETVLVAEEEAARVA
LRKLYGFTENRRPWDYSKPKESPKRAEQTSVAS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgctgtattccggttgctgcagcagggccctcgccgcctattggctccggcc
gtccccacgctggctcctccggttcggggagtgaagaagggattccgtgccgccttccgc
ttccagaaagagctggagcgatggcgcctgctacgctgcccgccgccgccagtgcgacgc
tcagagaagccaaactgggattaccatgcggaggtacaagcctttggatctcgcttacaa
gaaaccttttcgttggaccttctcaaaactgcatttatcaatagctgctacatcaaaagc
gaagaggcgaaacgtcagagccttggcatagagaaagaagctgctcttctgaatcttaag
gacaatcaggaactgttcgaacaagggctgtctttttcacatcggtgcctcacacagttt
ctcgaagacgaattcccagacttgcccgccgaaggcactgagagtctagttagctttctc
actggtgaggcagttgtctgtcacgtggccaggaacttggctgtggagcagttgaccctc
agtgcagaatttcctgtccccctgcctgtcttacgtcagactttcttcgcggtcattgga
gccctgctgcagagcagtggccctgaaagggctgcactgttcatcagggactttttaatt
acacaaatgacggggaaagagctctttgagatgtggaccgtcgtaaatcccatgggacta
ctcgtagaggagctgaagaagagaaacatctcagctcctgagtctcgactcaccaggcag
tctggaagcacaactgctctgcctttatattttgttggcttatactgtgacagaaagctg
attgcagagggacctggggaaactgtactcgttgcagaggaagaagctgcgcgcgtggcc
ctcaggaagctgtacggattcacagagaacaggcggccctgggactactccaagcccaaa
gagagcccaaagagagcagagcaaaccagcgttgccagctag

DBGET integrated database retrieval system