KEGG   Mus musculus (mouse): 69188Help
Entry
69188             CDS       T01002                                 

Gene name
Kmt2e, 1810033J14Rik, 9530077A04Rik, D230038D11Rik, Mll5, NKp44L
Definition
lysine (K)-specific methyltransferase 2E (EC:2.1.1.43)
Orthology
K09189  
histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    69188 (Kmt2e)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     69188 (Kmt2e)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    69188 (Kmt2e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 A3; 5
AA seq 1868 aa AA seqDB search
MSIAIPLGVDTTETSYLEMAAGSEPESVEASPVVVEKSNSFPHQLYTSSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPSGLISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDVTR
CICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRSLDKERAVLLQRRK
RENMSDGDTSATESGDEVPVELYTAFQHTPTSITLTASRVPKVTDKRRKKSGEKEQNFSK
CKKAFREGSRKSSRVKGSAPEIDPSSDSSNFVWETKIKAWMDRYEEANNNQYSEGVQREA
QRLAQRLGSGNDSKDMNKSELSTNNSLFRPPVESHIQKNKKILKSAKDLPPDALIIEYRG
KFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHE
IEEGTIHLYIYSIQSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECPVLKRSSESTEN
INSGYETRRKKGKKEKDTSKEKDIQNQNMTLDCEGTNNKIRSPETKQRKLSPLRLSVSNN
QEPDFIDDMEEKTPISNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQ
ALERISTAKTEVKPECKESQVIADAEVVQEQVKEETAIKPAAAKVNRTKQRKSFSRSRTH
IGQQRRRHRTVSMCSDIPPSSPDIEVLSQQNEIENTVLAIEPETETAVAEIIPEAEVPAL
NKCPTKYPKTKKHLVNEWLSEKNEKTGKPSDSLSERPLRITTDPEVLATQLNSLPGLTYS
PHVYSTPKHYIRFTSPFLSEKKRRKETTENISGSCKKRWLKQALEEENSTILHRYHSPCQ
ERSRSPTVNGENKSPLLLSDSCSLPDLTTPLKKRRLYQLLDTAYSESSTPTPSPYATPTH
TDITPTDPAFATPPRIKSDDETYRNGYKPIYSPVTPVTPGTPGNTMHFENISSPESSPEI
KRCTYNQEGYDRPSNMLTLGPFRNSNLTELGLQEIKTIGYTSPRSRTEVNRPCPGEKESV
SDLQLGLDAVEPAALQKSMETPAHDRTEPSNQLDSTHSGRGTMYSSWVKSPDRTGVNFSV
NSNLRDLTPSHQLETGGGFRVSESKCLIQQDDTRGMFLGAAVFCTSEDGLASGFGRTVND
NLIDGSCTPQNPPQKKKVSLLEYRKRQREARKSGSKPENFALISVSPHPSGSLSSSGDGC
VHSSENGEQAENQASLPLPPPAAAAAATAAAAYSASSEEGSSNCPVKDANSSEKKDPEVQ
WTASTSVEQVRERSYQRALLLSDHRKDKDSGGESPCVSCSPSHVQSPPSSHSNHIPQVHA
QSLAPSLSELMADPDAEGTEATSTSECPSPDTSQSPSKTSKPGSPGPINPAQSHGKILTK
PDSHWEATATVSEADNSVHQNPEPQHRQLSSNTPALSQNHAPQAHALSANDQLPQKLPSA
PTKLHCPPSPHTENPPKSSTPHTPVQHGYLSPKPPSQHLGSPFRPHHSQSPQVGTPQRET
QRNFYAAAQNLQANPQQATSGALFTQTPSGQSSATYSQFNQQSLNSTAPPPPPPPPPSSY
YQNQQPSANFQNYNQLKGSLSQQTVFTSGPNQALPGSTSQQSVPGHHVTPGHFLPSQNPT
IHHQPAAAAVVPPPPPPPPAPGPHLIQQPSSHQQHSVAHGVGPVHAVTPGSHIHSQTAGH
HLPPPPPPPGPAPHHHPPPHPTTGLQSLQAQHQHVVNSAPPPPPPPPPPPPASVLVSGHH
SASGQALHHPPHQGPPLFPASAHPAVPPYPSQATHHTTLGPGPQHQPSGTGPHCPLPVAG
PHLQPQGPNSIPTPTASGFCPHPHPGSVALPHGVQGPQQASPVPAQIPIHRAQVPPTFQN
NYHGSGWH
NT seq 5607 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagcgatcccattgggggttgatacaacagaaacatcctacttggaaatggct
gcaggctcagaaccggaatccgtagaagctagccctgtggtagttgagaaatccaacagt
tttccccaccagttatacaccagcagctcccaccactcacacagctacatcggtctgccc
tatgcggaccataattatggtgctcgtcctcctccaacacctccagcatcccctcctcca
tcaggtctcattagcaaaaacgaagtaggcatatttaccactcctaattttgatgaaact
tccagtgctactacaatcagcacatctgaagatggaagttacggtactgatgtaaccagg
tgcatatgtggttttacacatgatgacggatacatgatctgttgtgacaaatgcagtgtt
tggcaacatattgactgcatggggattgacaggcagcatattcctgatacatacctatgt
gaacgttgtcagcccaggagtttggataaagagagggcagtgctactgcaacgccggaaa
agagaaaatatgtcagatggtgataccagtgcaactgaaagtggtgatgaagttcctgtg
gaattatatactgcatttcagcatactccaacttcaatcactttaactgcttccagagtt
cccaaggttactgataaaagaaggaaaaaaagtggggagaaagaacaaaacttttcaaaa
tgtaaaaaagcctttcgtgaaggatctaggaaatcatcaagggttaagggttcagcacca
gaaattgatccttcatctgatagttcaaattttgtttgggaaacaaaaatcaaagcatgg
atggatcgttacgaagaagcaaataataaccaatatagtgaaggtgttcagagagaggca
caaagactagctcaaagactcggtagtgggaatgacagcaaagacatgaataaatcagaa
ttgagtaccaacaactcactcttcagacctcctgtagagagccatatacagaagaataaa
aaaattctgaaatctgccaaagacttgcctcctgatgcacttatcattgaatatagaggg
aagtttatgctgagagaacagtttgaagcaaatggatatttctttaaaaggccataccct
tttgttttattctactctaagttccatgggcttgaaatgtgtgttgatgcgaggactttt
gggaatgaggctcgattcatcaggcgttcttgtacaccgaatgcagaggtgaggcatgaa
attgaagaggggaccatacatctctacatttattctatacagagtattccaaaagggact
gaaattaccattgcctttgattttgactacgggaattgcaaatacaaggtggactgtgca
tgcctcaaggaaaatccagagtgccctgttctcaagcgaagctcggaatccacagaaaac
atcaatagtggttatgagaccagaaggaaaaaaggaaaaaaagagaaagatacttcaaaa
gaaaaagacatacaaaatcagaatatgactttggactgtgaaggaacaaacaacaaaata
aggagtccagaaacaaaacagagaaagctttctccattgaggctgtcggtgtcaaacaac
caggaaccagattttattgatgatatggaagaaaaaactcctattagcaatgaagtggaa
atggaatctgaggaacagattgcagaaaggaaaaggaagatgacaagagaagaaagaaaa
atggaagcaattttgcaggcttttgccagacttgagaagagagagaaaagacgagaacaa
gctttggaaaggatcagcacagctaagacagaagttaagcctgaatgcaaagagtcgcag
gtcatcgccgatgccgaagtggtgcaggaacaagtaaaagaagaaactgctatcaagcca
gccgctgccaaagtgaacagaactaagcagagaaagagcttttctcgtagtaggactcac
attggacagcagcgtcggagacacagaactgtcagcatgtgttcagacataccgccatct
tctcctgacatcgaagttctgtcacaacagaacgagattgaaaatactgtacttgctata
gaaccagaaactgaaactgcagtagcagaaataattcctgaagcggaagttccagcactt
aataagtgtcccacaaagtaccccaaaacaaagaagcacttggtcaatgaatggttaagt
gagaagaatgagaagacaggaaaaccttcagacagcctttcagaaaggcctctgcgcata
actacagatccagaggtgttagctacacagctcaattctttgccaggtctcacttacagc
ccccatgtatactctactcctaagcattatattagatttacatcaccattcctttcggaa
aaaaagagaagaaaagaaactactgaaaacatttctggctcatgcaaaaagcggtggctg
aagcaagccctggaggaagaaaattcaacaattttacatagatatcattcaccttgtcag
gaaagatccaggagtcctacagttaatggtgaaaacaaaagtccacttctgctaagcgac
agctgctccctcccagatttaaccacaccactaaaaaagcgaagactttaccaattgtta
gatactgcttactcagaaagctccactcctaccccttcaccatatgctacaccaactcac
acagacatcactcctacggacccagcatttgccactcccccacggatcaaatcagatgat
gaaacttacagaaatggttataaacccatatattcaccagtgacccctgtaacccctggc
acaccaggaaacaccatgcactttgagaatatttcttccccagaaagttctccagaaata
aagagatgcacttacaatcaagagggatatgaccgaccttcaaacatgctaacgttgggg
ccttttagaaattccaatttaactgagctgggcctgcaagaaataaagactattggttat
accagccctaggagcaggactgaggttaacaggccttgcccaggggagaaggagtctgtg
tcagaccttcaactgggactcgatgcagtcgagccagctgccttacagaaatccatggaa
acaccagcccatgacaggactgagcccagcaaccaactggattcgacccactctggacgg
ggcacaatgtattcatcctgggtaaagagtcctgacagaacaggagttaacttctcagta
aactccaacttgagggacttaacaccctctcatcagttggagactggaggcggcttccga
gtaagtgagtccaagtgcctgattcagcaggatgacactagaggcatgtttctgggagcg
gctgtcttttgtacttctgaagacgggcttgcctctggttttggacggactgttaatgac
aatttgatcgacgggagttgcacgccccagaatccaccacaaaagaaaaaggtttctcta
ttagaataccgtaagagacaacgtgaagctaggaagagtgggtctaagccagagaacttt
gctttgattagtgtgtcacctcacccgagtgggagcctgagcagcagtggcgacgggtgt
gtccacagcagtgaaaacggggagcaggcagaaaaccaggctagcttgcctttaccaccg
cctgctgccgccgccgccgccaccgccgccgccgcttacagtgcctcttctgaagaaggc
agcagtaactgtcctgttaaagacgccaattccagtgagaagaaagacccagaagttcag
tggactgcctccacttcagtggagcaagtgagagagagaagttaccagagagccttactg
ctcagtgaccaccgcaaagacaaagacagtgggggagagtcaccatgtgtctcatgctca
ccgagtcatgttcagtctccaccttcatctcattcaaatcacattccccaggtgcacgct
cagagcctagctccttctttgagtgaactcatggcagaccctgatgcggaaggtacagaa
gccacaagtacaagtgaatgtccatcccctgacacttctcagagcccttctaaaacaagc
aagcctggttcaccagggccaatcaatcctgctcagtcacatgggaaaatactcacaaaa
ccagatagccactgggaggcaactgccactgtatcagaagctgacaacagtgttcaccaa
aacccagagcctcagcacagacagctgtcaagtaacaccccagcactttctcagaaccat
gctcctcaggcccacgctctgagtgcgaatgatcaacttccgcaaaagctgccttctgca
ccgacgaagttgcactgtcctccgtcacctcacacagaaaaccctcccaagtcctccaca
cctcacacccccgtgcagcatggttacctctcgccaaagcctccttcacagcacttagga
tctcccttcaggcctcaccattcacaatcacctcaagttggaactcctcaacgagagact
cagagaaacttttatgcagcggcacagaaccttcaagctaatcctcagcaggcaacttct
ggagcgttatttacccagacaccctcaggacaatcttcagcaacctacagtcagttcaac
caacagagtctcaacagcacggccccaccccctccccctcctccccctccttcatcctac
tatcaaaaccagcagccctctgcaaactttcagaattataatcagctaaaaggtagtctt
tcccaacaaactgtgtttacatctggaccaaatcaagcacttcctggcagcaccagccag
caatcagttcctggacatcacgttactccagggcattttctgccatctcaaaaccccacc
attcaccatcaacctgctgctgctgctgtggtcccgcccccgcccccacccccgcccgct
ccaggaccacacctcatacagcagccaagctcacatcagcagcactctgtagcacatgga
gttgggccagttcatgctgttacccctgggtcacacattcattctcaaactgcaggacac
catttaccaccaccccctccaccacctggtcctgccccacatcaccatcccccaccccat
cctaccacgggactgcaaagtctacaagcacaacaccagcatgtagtaaactcggcaccc
ccgccccctccccctcccccgccccctcccccagccagtgttctggtttctgggcatcat
tcagcatcaggtcaagccttacaccacccacctcatcaaggacctccacttttccctgca
agcgctcatccagctgtcccgccgtacccctcacaagccacacatcataccactttggga
ccgggaccccaacaccagccttccggaacagggccacattgtccattaccagttgcaggt
cctcatctccagccccaaggaccaaacagtattccaacccctactgcttcagggttctgt
cctcatcctcatcctggctctgtggccctgccacatggggtgcaaggacctcagcaggca
tcgccagtgcctgcacagattccaattcacagagcacaggtgccgccgacatttcaaaac
aattaccacggttcagggtggcattaa

DBGET integrated database retrieval system