KEGG   Mus musculus (mouse): 69191Help
Entry
69191             CDS       T01002                                 

Gene name
Pdia2, 1810041F13Rik, AI661267, Pdip, Pdipl
Definition
protein disulfide isomerase associated 2 (EC:5.3.4.1)
Orthology
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     69191 (Pdia2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 A3.3; 17
AA seq 527 aa AA seqDB search
MDKQLLPVLLLLLGVSGSWGQGEEPGGPSEVLPEEPTGEEVPKEDGILVLNHRTLSLALQ
EHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEVVGY
PTLKFFQNGNRTNPEEYAGPKTAEGIAEWLRRRVGPSATHLEDEEGVQALMAKWDMVVIG
FFQDLQGKDMATFLALAKDALDMTFGFTDQPQLFEKFGLTKDTVVLFKKFDEGRADFPVD
KETGLDLGDLSRFLVIHSMHLVTEFNSQTSPKIFAAKILNHLLLFVNQTLAQHRELLTDF
REAAPPFRGQVLFVMVDVAADNSHVLNYFGLKAEEAPTLRLINVETTKKYAPTGVIAITA
ASVAAFCQAVLHGEIKHYLLSQEIPPDWDQGPVKTLVSKNFEQVAFDETKNVFVKFYAPW
CSHCKEMAPAWEALAEKYKDREDIVIAELDATANELEAFSVLGYPTLKFFPAGPDRKVID
YKSTRDLETFSKFLDSGGHLPKEEPKEPAASAPEAQANSTLGPKEEL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggacaagcagcttctgccagtgttgctgctcctgctgggtgtctcaggctcatgggga
cagggagaagagcctgggggtccttcagaggtgctccctgaggagcccactggggaagaa
gtccccaaggaggatggtatcttggtcttgaaccaccgaaccctgagcctggcactgcag
gagcattcagccctgatggtggagttttatgccccatggtgtggtcactgcaaagaacta
gctcccgagtacagcaaggcggctgccctgctggcggctgagtcagctgtggtcaccttg
gccaaggtggatggccctgcggaaccggagctgaccaaggagtttgaagtggtagggtac
cctacactcaagttcttccagaatggaaaccgcacaaacccagaagagtacgcagggccc
aagactgctgagggcattgctgagtggctgaggcggcgagtggggcccagtgccacacat
ctggaggatgaggaaggtgtccaggcactgatggccaaatgggatatggtggtcattggc
ttctttcaggatctacagggaaaggatatggcaactttcctggccttggccaaggatgcc
ctggacatgacctttggcttcactgaccagccacaactttttgagaagtttggcctcacc
aaggatactgtggtccttttcaagaagtttgatgagggtcgggccgacttcccggtagac
aaggagactggcctggacctgggggacctgtcccgcttcctcgtcatacatagcatgcac
ctggtcacagaattcaacagccagacatcacctaagatctttgcagccaagatcctcaac
cacctgctgctgtttgtgaaccagacactagctcaacacagggaactgctgacagacttc
agagaggcagctcctccattcagggggcaggtgttgttcgtaatggtggatgtggctgct
gacaacagccatgtgctgaattattttggcctcaaggctgaggaagcccccaccctgcgt
ctgatcaatgttgagactaccaagaagtatgcacctacaggggtgatagccatcactgca
gcttctgtggctgccttctgccaggcagttctccatggggaaatcaagcactatctcctg
agtcaggagataccccctgactgggaccaggggccagtcaagactctcgtgagcaagaat
tttgagcaggttgcctttgatgaaaccaagaatgtgtttgtcaagttctatgccccatgg
tgcagccactgcaaggagatggctccagcctgggaggcattggcagagaagtacaaggat
cgtgaggacattgtcattgccgagttggatgctacagctaatgagctggaggccttctct
gtgctcggctatcccactctcaagttctttcctgcagggcctgaccgaaaggttatagac
tacaaaagcactagggacctagagacattctccaagttcctggacagcggaggtcacctg
cctaaggaggaacccaaggagcctgcagcctctgccccagaagcacaagccaattccacc
ttgggtcccaaggaggagctgtag

DBGET integrated database retrieval system