KEGG   Mus musculus (mouse): 69382Help
Entry
69382             CDS       T01002                                 

Gene name
1700024P04Rik, H2bl1, Subh2bv
Definition
(RefSeq) RIKEN cDNA 1700024P04 gene
  KO
K11252  histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05034  Alcoholism
mmu05203  Viral carcinogenesis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    69382 (1700024P04Rik)
  Immune diseases
   05322 Systemic lupus erythematosus
    69382 (1700024P04Rik)
  Substance dependence
   05034 Alcoholism
    69382 (1700024P04Rik)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    69382 (1700024P04Rik)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   69382 (1700024P04Rik)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TAF
Motif
Other DBs
NCBI-GeneID: 69382
NCBI-ProteinID: NP_081340
MGI: 1916632
Ensembl: ENSMUSG00000045022
Vega: OTTMUSG00000033617
UniProt: Q9D9Z7
Position
13; 13 D1
AA seq 123 aa AA seqDB search
MAKPTFKRQCYIKRHLRPLYRKHSRCSSINLGHGNYSLYINRVLKEVVPNRGISSYSVDI
MNILINDIFERIATEACQQMFLRKRCTLTPGDIQQAVHLLLPKKLATLAVTFGSKAVHRF
IHS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcccaccttcaaaagacaatgctacatcaaaagacatctaagaccattgtat
agaaagcactcacgttgctctagcatcaatttgggccatggaaattactccctttacata
aacagagtcctgaaggaagttgtccctaacaggggtatatcatcctattctgtggacatc
atgaacatcctcatcaatgacatcttcgaacgcattgctacggaagcctgccagcagatg
ttcctcagaaagcgctgtaccctcaccccaggagatatccagcaggcagtgcatctgctg
ttgccgaagaagctggctacgcttgctgtgacttttggaagtaaagccgtccacagattc
attcattcctaa

DBGET integrated database retrieval system