KEGG   Mus musculus (mouse): 69382Help
Entry
69382             CDS       T01002                                 

Gene name
1700024P04Rik, H2bl1, Subh2bv
Definition
RIKEN cDNA 1700024P04 gene
Orthology
K11252  
histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    69382 (1700024P04Rik)
  Immune diseases
   05322 Systemic lupus erythematosus
    69382 (1700024P04Rik)
  Substance dependence
   05034 Alcoholism
    69382 (1700024P04Rik)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   69382 (1700024P04Rik)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 D1; 13
AA seq 123 aa AA seqDB search
MAKPTFKRQCYIKRHLRPLYRKHSRCSSINLGHGNYSLYINRVLKEVVPNRGISSYSVDI
MNILINDIFERIATEACQQMFLRKRCTLTPGDIQQAVHLLLPKKLATLAVTFGSKAVHRF
IHS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcccaccttcaaaagacaatgctacatcaaaagacatctaagaccattgtat
agaaagcactcacgttgctctagcatcaatttgggccatggaaattactccctttacata
aacagagtcctgaaggaagttgtccctaacaggggtatatcatcctattctgtggacatc
atgaacatcctcatcaatgacatcttcgaacgcattgctacggaagcctgccagcagatg
ttcctcagaaagcgctgtaccctcaccccaggagatatccagcaggcagtgcatctgctg
ttgccgaagaagctggctacgcttgctgtgacttttggaagtaaagccgtccacagattc
attcattcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system