KEGG   Mus musculus (mouse): 69382Help
Entry
69382             CDS       T01002                                 

Gene name
1700024P04Rik, H2bl1, Subh2bv
Definition
RIKEN cDNA 1700024P04 gene
Orthology
K11252  
histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:mmu05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:mmu05322]
Human Diseases; Substance dependence; Alcoholism [PATH:mmu05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 D1; 13
AA seq 123 aa AA seqDB search
MAKPTFKRQCYIKRHLRPLYRKHSRCSSINLGHGNYSLYINRVLKEVVPNRGISSYSVDI
MNILINDIFERIATEACQQMFLRKRCTLTPGDIQQAVHLLLPKKLATLAVTFGSKAVHRF
IHS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcccaccttcaaaagacaatgctacatcaaaagacatctaagaccattgtat
agaaagcactcacgttgctctagcatcaatttgggccatggaaattactccctttacata
aacagagtcctgaaggaagttgtccctaacaggggtatatcatcctattctgtggacatc
atgaacatcctcatcaatgacatcttcgaacgcattgctacggaagcctgccagcagatg
ttcctcagaaagcgctgtaccctcaccccaggagatatccagcaggcagtgcatctgctg
ttgccgaagaagctggctacgcttgctgtgacttttggaagtaaagccgtccacagattc
attcattcctaa

DBGET integrated database retrieval system