KEGG   Mus musculus (mouse): 69389Help
Entry
69389             CDS       T01002                                 

Gene name
H2bfm, 1700014N06Rik, H2bfw, H2bl2
Definition
H2B histone family, member M
Orthology
K11252  
histone H2B
Organism
mmu  Mus musculus (mouse)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    69389 (H2bfm)
  Immune diseases
   05322 Systemic lupus erythematosus
    69389 (H2bfm)
  Substance dependence
   05034 Alcoholism
    69389 (H2bfm)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   69389 (H2bfm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X F1; X
AA seq 224 aa AA seqDB search
MASTTAMDVLEELSSDSSEKQVQPRKPEKAKREKDKPKKGGPEKKAKKEKQEKAKPEKKP
KKKPEKEKPEGEKLEKKPKKDKREKAKPKKKPEQENREQETPEQEKPEVQRRRSLHQSIR
EDERRARLIRRRKNSFAIYFPKVLKNIHVGLSLSQRSVNILDSFVKDMFERIASEASFLA
RQARNSTINSREIQTAIRLLLPGELCRRAVAEGTMAMVRYISNK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctaccacggctatggacgttctggaggagctatcttcggatagttccgaaaaa
caggtacaaccaagaaagcctgagaaagctaaaagggaaaaggacaaaccaaagaaaggg
gggccggagaagaaggccaagaaagagaaacaggagaaagcaaagccggagaaaaagccg
aagaagaagccagagaaagagaagccggagggagagaagctggagaagaaacccaagaaa
gacaagcgggagaaagcgaagccgaagaagaagcccgagcaagagaaccgtgagcaagag
actcctgagcaggagaagcctgaggtgcagcggcgtcgctcacttcaccaaagcatcagg
gaagatgagcgtagagcccgtctgatcagacgccgtaagaacagcttcgctatctacttt
ccgaaggtgctgaaaaatatccacgtgggtctctccctctcgcagcggtctgtgaacatc
ctggattcattcgtgaaggatatgtttgaaagaattgcatccgaagccagcttcttggcg
cgtcaagccagaaactctactatcaactccagagagatccagaccgctattcgacttctg
cttcctggcgagctctgccggcgtgcagtggctgaaggaaccatggcgatggtccggtat
atctccaacaagtaa

DBGET integrated database retrieval system