KEGG   Mus musculus (mouse): 69635Help
Entry
69635             CDS       T01002                                 

Gene name
Dapk1, D13Ucla1, DAP-Kinase
Definition
(RefSeq) death associated protein kinase 1 (EC:2.7.11.1)
  KO
K08803  
death-associated protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Pathways in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    69635 (Dapk1)
   05219 Bladder cancer
    69635 (Dapk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     69635 (Dapk1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  DAPK family
   69635 (Dapk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
13 B2; 13 32.53 cM
AA seq 1442 aa AA seqDB search
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIRHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILSGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYDFEEEF
FRNTSTLAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSSYDVNQPNKHGTPPLLIAAGCGNIQMLQLLIKRGSRIDVQDKGGSNAIYWAS
RHGHVDTLKFLNENKCPLDVKDKSGETALHVAARYGHADVVQLLCSFGSNPDFQDKEEET
PLHCAAWHGYYSVAKALCEVGCNVNIKNREGETPLLTASARGYHDIVECLAEHGADLNAS
DKDGHIALHLAVRRCQMEVIKTLLGHGSFVDFQDRHGNTPLHVACKDGSAPIVVALCEAS
CNLDISNKYGRTPLHLAANNGILDVVRYLCLMGANVEALTSDGKTAEDLAKAEQHEHVAG
LLARLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKSTLVESLKCGLLRSFFRRRR
PRLSSTNSTRFPPSPLAAKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAP
SHHLHCSTDDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHIIVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLRVVLVATHADIMNIPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHVSNKLFVLDAGASGSKDIKVLRNHLQEIRSQIVSGCS
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEDDLRRIAQQLHSTGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTMEDIQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDIPALIKTDSLQRSWADEEDEVMVYGGVRIVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSAEGDADIRLWVSGCRIANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIETVMATTLPGLLTVKHYLSPQQLREHHEPVMVYQPRDFFRA
QTLKESSLTNTMGGYKESFSSITCFGCHDVYSQASLGMDIHASDLSLLTRRKLSRLLDPP
DPMGKDWCLLAMNLGLPDMVAKHNVNNRASRDFLPSPVHALLQEWTSYPESTVGILISKL
RELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSRRDSHAWTPLY
DL
NT seq 4329 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgttcaggcaggaaaacgtggacgactactacgacaccggcgaggaactgggc
agtggacagttcgcagttgtgaagaaatgtcgtgagaaaagtaccggtcttcagtatgcg
gccaagttcatcaagaaaaggaggaccaagtccagccggcggggcgtgagccgggaggac
atcgagcgggaggtcagcatcctgaaggagatccggcacccaaatgtcatcaccctgcat
gaggtctatgagaacaagacagatgtcattctgatcctggagcttgttgcaggaggtgag
ctgtttgacttcctggctgagaaggaatctctgactgaagaggaggcaacggaattcctt
aagcagattctcagcggcgtttactacctgcactcactgcagatcgctcactttgacctg
aagccggaaaacataatgcttctggatagaaatgtgcccaaacctcggatcaagatcata
gactttggcttggcccataaaattgactttggaaatgaattcaaaaacatatttgggaca
ccagagtttgtggctccggagatagtcaactatgagcccctgggtcttgaggcagatatg
tggagcatcggggtaataacctatatcctcctaagtggggcctccccttttcttggagac
accaagcaagaaacattagcgaatgtgtccgctgtcaactacgactttgaggaggaattc
ttccggaacaccagtacccttgccaaagatttcatcagaagactgctggtcaaggatcca
aagaagaggatgacaatccaggacagtttgcagcacccctggatcaagcctaaagacacc
caacaagcacttagtcgaaaagcctcagcagtaaacatggagaaattcaagaagtttgca
gctcggaaaaaatggaaacaatctgttcgcttgatatcactgtgccaaagattatccagg
tcatttttgtccagaagtaacatgagtgtcgccaggagtgatgatactctggatgaggaa
gactcctttgtgatgaaagccatcatccatgccatcaatgatgacaacgtacccggcctg
cagcatctcctgggctccttgtccagctatgacgtcaaccagcccaacaagcatgggaca
cctccattactgattgccgcaggctgtggcaacatccagatgttacagttactcataaaa
cgaggctcaaggattgacgtccaggataagggaggatccaatgccatctactgggcctct
cggcatggccatgtggatactttgaaatttctcaatgagaacaaatgccctttggatgtt
aaagacaagtctggagagacagctcttcacgtggcagcccgctatggccatgcagatgtg
gttcaactactgtgcagttttggctctaatcctgatttccaggacaaggaagaggaaacc
cccctgcactgtgctgcctggcatggctattactccgtggctaaagctctttgtgaagtt
ggctgcaacgtgaatatcaagaatcgggagggagagaccccattgctgacggcgtctgcc
aggggctatcatgacattgtggagtgtctggctgaacatggagctgacttgaatgcttct
gacaaggatggacacatcgctcttcatcttgctgtgaggcgttgtcagatggaagtcatc
aagaccctccttggccatgggtcctttgtggatttccaggacaggcatggcaacacaccc
ctgcacgtggcctgcaaagatggaagcgcacctatcgtggtggccctctgtgaagccagc
tgcaatctggacatctcaaacaagtatggtcggactcctctccaccttgcagccaacaac
gggatcctagatgtggtccgctacctctgtttgatgggcgccaatgtggaggctctaacc
tcggatggaaagacggccgaggacctcgccaaggcagaacagcacgagcatgtggcaggg
ctcctggcaagactgcggaaggacacacaccgaggactcttcatccagcaactccgaccc
acccagaatctccagcccagaatcaagctcaaactgtttggccattcgggatcagggaaa
tccaccctggtggaatctctcaagtgtgggctgttaaggagtttcttcagaaggcgccgg
cccagactatcctctaccaactccacccgcttcccaccgtcacccctggctgctaagcca
acagtctcagtgagcattaacaacctgtaccccggctgtgagaacgtgagcgtaaggagc
cgcagcatgatgttcgagccgggcctcaccaaagggatgctggaagtgttcgtggctccg
tctcaccacctccactgctcgactgatgaccagtccaccaaagccatcgacatccagaat
gcttatttgaacggagttggtgatttcagtgtgtgggagttctctggaaaccctgtgtac
ttctgttgctatgactactttgctgccaacgaccccacgtccatccacatcatcgttttc
agtctcgaagaaccctatgagatccagctgaaccaagtgattttctggctcagtttcctg
aagtctctggtcccagttgaagaacccatagcatttggaggcaagctgaagaaccctctc
cgagttgtcctggtggcaacacatgctgacatcatgaacatccctcggcctgctggaggc
gagtttggatatgacaaggatacatccttgctgaaagagatcagaaacaggttcgggaat
gaccttcatgtctcaaacaagctgtttgtcctggatgcaggagcgtctgggtctaaggac
attaaggttcttcggaatcacctgcaagaaatacggagccagattgtctcggggtgttcg
cccatgactcacctgtgcgagaagatcatctccacgctgccctcctggcggaagctcaac
gggccaaaccagctgatgtcgctgcagcagtttgtgtatgacgtgcaggaccagctgaac
cccctggcctctgaggatgacctcaggcgcattgcacaacagctacacagcacgggcgag
ataaacatcatgcagagtgagacagtgcaggacgtgttactgctggatcctcgatggctc
tgcaccaacgtcctggggaagctgctgtctgtggagacgccccgagccctgcaccattac
cggggccgctacaccatggaagacatccagcgtctggtcccagacagtgacgtggaggag
ctgctgcagatactggatgccatggacatctgcgcccgagacctgagtagtgggactatg
gtggatatccctgctctgatcaaaacagacagcctgcagcgctcctgggcggatgaggag
gatgaggtgatggtgtacggtggggtgcgcattgtccctgtagagcacctcacccccttc
ccctgtggcatctttcacaaagttcaggtcaacctgtgccgatggatccaccagcaaagc
gcggagggtgatgcggacatccgtctgtgggtgagcggctgcaggatcgccaaccgcggg
gctgagttgctggtgctgctggtcaatcacggtcagggcatcgaggtacaggtgcgtggc
ctggagacggagaagattaagtgctgcctgctgctggactcggtgtgcagcaccatcgag
accgtcatggccaccaccttgccagggttgttgacggtgaagcactacctgagcccccag
cagctaagggagcaccacgaaccggtcatggtctatcagccccgggacttcttccgtgcg
cagaccctgaaagagagttcccttaccaacaccatgggtgggtacaaggagagcttcagc
agcatcacgtgctttgggtgtcatgacgtctactcacaggccagtcttggcatggatatc
catgcgtcagacctgagtctcctgacccggaggaaactgagtcgcctgcttgacccaccc
gaccccatggggaaggactggtgccttctggccatgaacttgggcctcccagacatggtg
gccaaacacaacgtcaacaacagggcttctagggatttcctccctagcccagtgcatgcc
ttgctacaggaatggacctcctaccctgagagcacggtgggcatccttatatccaaactt
cgggagctggggcgccgggatgctgcggactttttactgaaggcctcctctgtgttcaag
atcaaccttgatggcaatggccaggaggcctatgcctcaagctgtaacagtggcacgtcc
tacaattccattagctcagtggtgtcccggagagactcccatgcttggaccccactgtat
gatttataa

DBGET integrated database retrieval system