KEGG   Mus musculus (mouse): 69727Help
Entry
69727             CDS       T01002                                 

Gene name
Usp46, 1190009E20Rik, 2410018I08Rik, AI451644
Definition
ubiquitin specific peptidase 46 (EC:3.4.19.12)
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
5 C3.3; 5
AA seq 366 aa AA seqDB search
MTVRNIASICNMGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFR
ENVLAYKAQQKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQD
AHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNET
RCLNCETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSEQKYYCETCCSKQEAQK
RMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSSDAVNLDRMYDLVA
VVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYIL
FYQSRE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactgtccgaaacatcgcctccatctgtaatatgggcaccaatgcctctgctctggaa
aaagacattggaccagagcagtttccgatcaatgaacactacttcggattggtcaatttt
ggaaacacatgctactgtaactccgtgcttcaagcgctgtacttctgccggccgttccgg
gagaatgtgttggcatacaaggcccagcaaaaaaagaaggaaaacctgttgacatgcctg
gcagaccttttccacagcattgccacgcagaagaagaaggttggcgtcatcccaccaaag
aagttcatttcaaggctgaggaaagagaacgatctctttgataactacatgcagcaggat
gctcacgagttcttaaattatttgctaaacactattgcggacatcctgcaggaagagaag
aaacaggaaaaacaaaacgggaagttaaaaaacggcaacatgaacgaaccagccgagaac
aataagccagaactcacctgggtccacgagatttttcagggaacactcactaacgaaact
cgatgcttgaactgtgaaactgtgagtagcaaagatgaagattttcttgacctctctgtc
gatgtggaacagaacacctccatcacccactgtctgagagacttcagcaacacagaaacg
ctgtgtagtgaacaaaaatattattgtgaaacatgttgcagcaaacaggaggctcagaag
aggatgagggtaaaaaagctgcccatgattttggccctgcacctcaagaggttcaagtac
atggaacagctccacaggtacaccaagctgtcttaccgggtggtcttccctctggaactc
cggctcttcaacacctccagcgatgctgtgaacctggaccgcatgtatgacctggttgct
gtggtcgttcactgtggaagtggtcctaaccgtgggcattacatcaccatcgtaaaaagt
catggcttctggctgttgtttgatgacgacattgtagagaaaatagacgctcaagccatt
gaggaattctatggtctaacgtcagatatatcaaaaaattcagaatctggatatatttta
ttctatcaatcaagagaataa

DBGET integrated database retrieval system