KEGG   Mus musculus (mouse): 69731Help
Entry
69731             CDS       T01002                                 

Gene name
Gemin7, 2400008I04Rik, AI120175, AI461688
Definition
gem (nuclear organelle) associated protein 7
Orthology
K13135  
gem associated protein 7
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:mmu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
7 A3; 7
AA seq 129 aa AA seqDB search
MQSPLTIPVPVPVLRLPRGPDGFSRGFASDGRRTILRPEVGEGHIQDPPESQEQRARATL
RERYLRSLLAMVGHPVSFTLHEGVHVTAQFGATDLDVANFYVSQLQTPIGVQAEALLRCS
DIISYSFKL
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcccactgaccattcctgtgccggtgccagtgctgcgcctccctcggggcccc
gatggcttcagcagaggctttgcctctgatggacgtaggaccatcctgagaccagaagtc
ggagaaggtcatattcaagatcccccagagtcacaggaacagcgggcccgagccactctg
cgagagcgctacctccgcagcctcctagccatggtggggcaccctgtgagtttcacgctg
cacgaaggtgtgcatgtgaccgcccagtttggagccacagacctggatgtggccaacttc
tacgtttcccaactgcagactcccataggtgtacaggccgaggccttgcttcgatgtagt
gacataatttcctattctttcaagctgtaa

DBGET integrated database retrieval system