KEGG   Mus musculus (mouse): 69745Help
Entry
69745             CDS       T01002                                 

Gene name
Pold4, 2410012M21Rik, AI463381, AW060307, Polds, p12
Definition
polymerase (DNA-directed), delta 4
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mmu00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mmu00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:mmu03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mmu03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mmu03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mmu03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mmu03440]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mmu05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 A; 19
AA seq 107 aa AA seqDB search
MGRKRFITDSYPVVKKREGPPGHSKGELAPELGEDTQSLSQEETELELLRQFDLAWQYGP
CTGITRLQRWSRAEQMGLKPPLEVYQVLKAHPEDPHFQCSLWHLYPL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggtcggaagcggttcatcactgactcctatcctgttgtgaagaagagggaggggccc
cctgggcacagcaagggagagctggcacccgagctaggggaagacacccagtccctcagc
caggaggaaacagagctggagctgctgaggcagtttgacctggcctggcagtatgggcct
tgtacaggtatcacaaggctgcagcgctggagtcgggcagagcagatgggcttgaagccc
cccctagaggtgtaccaagtgttgaaggcacaccctgaagaccctcacttccaatgcagc
ctgtggcatctctacccactctga

DBGET integrated database retrieval system