KEGG   Mus musculus (mouse): 69745Help
Entry
69745             CDS       T01002                                 

Gene name
Pold4, 2410012M21Rik, AI463381, AW060307, Polds, p12
Definition
polymerase (DNA-directed), delta 4
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    69745 (Pold4)
   00240 Pyrimidine metabolism
    69745 (Pold4)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    69745 (Pold4)
   03410 Base excision repair
    69745 (Pold4)
   03420 Nucleotide excision repair
    69745 (Pold4)
   03430 Mismatch repair
    69745 (Pold4)
   03440 Homologous recombination
    69745 (Pold4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    69745 (Pold4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      69745 (Pold4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 A; 19
AA seq 107 aa AA seqDB search
MGRKRFITDSYPVVKKREGPPGHSKGELAPELGEDTQSLSQEETELELLRQFDLAWQYGP
CTGITRLQRWSRAEQMGLKPPLEVYQVLKAHPEDPHFQCSLWHLYPL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggtcggaagcggttcatcactgactcctatcctgttgtgaagaagagggaggggccc
cctgggcacagcaagggagagctggcacccgagctaggggaagacacccagtccctcagc
caggaggaaacagagctggagctgctgaggcagtttgacctggcctggcagtatgggcct
tgtacaggtatcacaaggctgcagcgctggagtcgggcagagcagatgggcttgaagccc
cccctagaggtgtaccaagtgttgaaggcacaccctgaagaccctcacttccaatgcagc
ctgtggcatctctacccactctga

DBGET integrated database retrieval system