KEGG   Mus musculus (mouse): 69772Help
Entry
69772             CDS       T01002                                 

Gene name
Bdh2, 1810026B04Rik, Dhrs6
Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase, type 2
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00072  Synthesis and degradation of ketone bodies
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    69772 (Bdh2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    69772 (Bdh2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     69772 (Bdh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR AlaDh_PNT_C ADH_zinc_N 3HCDH_N UDPG_MGDP_dh_N DUF1776 DUF2325
Motif
Other DBs
NCBI-GeneID: 69772
NCBI-ProteinID: NP_081484
MGI: 1917022
Ensembl: ENSMUSG00000028167
Vega: OTTMUSG00000029709
UniProt: Q8JZV9
Position
3; 3 G3
AA seq 245 aa AA seqDB search
MGRLDGKVIVLTAAAQGIGRASALAFAREGAKVIATDINESKLQELESYRGIQTRVLDVT
KKRQIDQFASEIERIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMFLMIKAFLPKM
LAQKSGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTV
DTPSLQERIQARDNPKEALKTFLNRQKTGRFASAEEVALLCVYLASDESAYVTGNPVIID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggccgactggacggcaaagttattgtcctgacagctgccgctcaagggattggacgg
gcatccgcattagcttttgcaagagaaggagccaaagtcatagccacagatatcaacgag
tccaaactccaggagctggaaagttaccgaggtattcaaactcgagtccttgatgtcaca
aagaagagacagattgatcagtttgcctcagaaatcgagagaattgatgttctctttaat
gttgctggttttgtccaccacggaaccatcctggattgcgaggaaaaagactgggacttc
tcaatgaatctcaacgtccgcagcatgttcctgatgatcaaagcattccttcccaaaatg
cttgctcagaagtcaggcaacattatcaacatgtcgtctgtggcctccagcatcaaaggg
gtggagaacagatgtgtgtacagtgctaccaaggcggctgtgatcggtctcaccaagtcc
gtggctgcagacttcatccaacagggcatcagatgcaactgtgtgtgtccaggaacggtt
gacaccccatctctgcaagaaagaatacaagccagagacaatcccaaagaggcactgaaa
actttcctaaacagacaaaagacgggaaggtttgcgtcggccgaagaggtcgctctgctc
tgcgtatacctggcctcggacgagtcagcctatgtaactggcaaccctgtcatcattgat
gggggctggagcctgtga

DBGET integrated database retrieval system