KEGG   Mus musculus (mouse): 69772Help
Entry
69772             CDS       T01002                                 

Gene name
Bdh2, 1810026B04Rik, Dhrs6
Definition
3-hydroxybutyrate dehydrogenase, type 2 (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mmu  Mus musculus (mouse)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    69772 (Bdh2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    69772 (Bdh2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     69772 (Bdh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 H2
AA seq 255 aa AA seqDB search
MSLDCAAGSTMGRLDGKVIVLTAAAQGIGRASALAFAREGAKVIATDINESKLQELESYR
GIQTRVLDVTKKRQIDQFASEIERIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMF
LMIKAFLPKMLAQKSGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGI
RCNCVCPGTVDTPSLQERIQARDNPKEALKTFLNRQKTGRFASAEEVALLCVYLASDESA
YVTGNPVIIDGGWSL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtctttggattgtgccgcaggatccactatgggccgactggacggcaaagttattgtc
ctgacagctgccgctcaagggattggacgggcatccgcattagcttttgcaagagaagga
gccaaagtcatagccacagatatcaacgagtccaaactccaggagctggaaagttaccga
ggtattcaaactcgagtccttgatgtcacaaagaagagacagattgatcagtttgcctca
gaaatcgagagaattgatgttctctttaatgttgctggttttgtccaccacggaaccatc
ctggattgcgaggaaaaagactgggacttctcaatgaatctcaacgtccgcagcatgttc
ctgatgatcaaagcattccttcccaaaatgcttgctcagaagtcaggcaacattatcaac
atgtcgtctgtggcctccagcatcaaaggggtggagaacagatgtgtgtacagtgctacc
aaggcggctgtgatcggtctcaccaagtccgtggctgcagacttcatccaacagggcatc
agatgcaactgtgtgtgtccaggaacggttgacaccccatctctgcaagaaagaatacaa
gccagagacaatcccaaagaggcactgaaaactttcctaaacagacaaaagacgggaagg
tttgcgtcggccgaagaggtcgctctgctctgcgtatacctggcctcggacgagtcagcc
tatgtaactggcaaccctgtcatcattgatgggggctggagcctgtga

DBGET integrated database retrieval system