KEGG   Mus musculus (mouse): 69821Help
Entry
69821             CDS       T01002                                 

Gene name
Mterf4, 1810059A23Rik, 4933412H03Rik, Mterfd2
Definition
(RefSeq) mitochondrial transcription termination factor 4
  KO
K15032  
mTERF domain-containing protein, mitochondrial
Organism
mmu  Mus musculus (mouse)
Brite
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Release factors
   69821 (Mterf4)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    69821 (Mterf4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 D
AA seq 346 aa AA seqDB search
MASLGRQVPEWHRLLALSWACLVRQTPHLREQKQMSPSLSCKLTTVPGRGSFQEFSSITP
QKYMQEPENRTRLVQCLHEEQKPCVDPESLEPEKVIRSLQDMGFAEAHIHSLFSIQPSVH
PQQLLGIVSELLLLGLNPEPVFNALKKNPQLLKLSSMQMKRRSSYLRKLGLGEGKLKRVL
SVCPEVFTMHQRDIDRVVKVLREKCLFTAQHITDVLHRCPTVLQEDPNELEYKFQYAYFR
MGLTHLDIVRTNFLQYSITKIKQRHIYLERLGRYQTPDKKGQTQIPNPSLRNILRVSEAE
FLARTACSSVEEFQVFKKLLDQEEEEESESHASEEEEEEEEEEELL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgctgggaaggcaggttcctgagtggcatcgtctactggccctctcctgggcc
tgtttggttaggcagacccctcatctcagagaacagaaacagatgagcccttctttgtct
tgcaaactgactacagtgcccggtagaggaagctttcaagagttttccagcattacaccc
caaaagtacatgcaggaaccagaaaacaggacacgacttgttcagtgtcttcatgaggaa
cagaagccttgtgtggatcctgagtccttggagcctgaaaaggtcatccgttccctccag
gacatgggttttgctgaagcccacattcacagcttgtttagtatacagccaagtgtccat
cctcaacagttgctgggtatagtttcagaactcctactcttggggttgaacccagagcct
gtatttaatgccttgaagaaaaatccccagttgctgaaactgtctagcatgcagatgaag
aggcgttccagttaccttcggaagcttggccttggagaagggaaactgaagcgggtgctg
tccgtttgccctgaggttttcaccatgcatcagcgggacattgaccgagttgtgaaggtc
ctcagggagaagtgcttgttcacggcacagcacatcacagacgttctgcacagatgcccc
actgttttgcaggaggaccccaacgagctagaatacaaattccagtatgcatatttcagg
atgggactcacacatctagacatagtcaggacgaatttcttacagtattcaataaccaag
atcaagcagagacacatttacctggagcgccttggacggtaccagacccctgataagaag
gggcagacacagatccctaatccctcactgaggaacattctcagagtttctgaagctgag
tttttggccaggacagcctgttcctctgtcgaggagtttcaagtttttaaaaaactcttg
gatcaagaggaggaggaggagtctgagagccatgcatctgaggaggaagaggaagaggag
gaagaggaggagctactgtga

DBGET integrated database retrieval system