KEGG   Mus musculus (mouse): 69847Help
Entry
69847             CDS       T01002                                 

Gene name
Wnk4, 2010002J11Rik, Pha2b, Prkwnk4
Definition
(RefSeq) WNK lysine deficient protein kinase 4
  KO
K08867  
WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     69847 (Wnk4)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  Wnk family
   69847 (Wnk4)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     69847 (Wnk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 D
AA seq 1222 aa AA seqDB search
MLAPRNTETGVPMSQTEADLALRPSPALTSTGPTRLGPPPRRVRRFSGKAEPRPRSSRPS
RRSSVDLGLLSSWSQPASLLPEPPDPPDSAGPTRSPPSSSKEPPEGTWMGAAPVKAVDSA
CPELTGSSGGPGSREPPRVPDAAARERRREQEEKEDTETQAVATSPDGRYLKFDIEIGRG
SFKTVYRGLDTDTTVEVAWCELQTRKLSRAERQRFSEEVEMLKGLQHPNIVRFYDSWKSV
LRGQVCIVLVTELMTSGTLKTYLRRFREMKPRVLQRWSRQILRGLHFLHSRVPPILHRDL
KCDNVFITGPSGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGM
CMLEMATSEYPYSECQNAAQIYRKVTSGTKPNSFYKVKMPEVKEIIEGCIRTDKNERFTI
QDLLAHAFFREERGVHVELAEEDDGEKPGLKLWLRMEDARRGGRPRDNQAIEFLFQLGRD
AAEEVAQEMVALGLVCEADYQPVARAVRERVAAIQRKREKLRKARELEVLPPDSGPPPAT
VSLAPGPPSAFPPEPEEPEADQHQSFLFRHASYSSTTSDCETDGYLSSSGFLDASDPALQ
PPGGLPSSPAESHLCLPSGFALSIPRSGPGSDFSPGDSYASDAASGLSDMGEGGQMRKNP
VKTLRRRPRSRLRVTSVSDQSDRVVECQLQTHNSKMVTFRFDLDGDSPEEIAAAMVYNEF
ILPSERDGFLSRIREIIQRVETLLKRDAGPPEAAEDALSPQEEPAALPALPGPPNAEPQR
SISPEQRSWAAFSTSPSSPGTPLSPGAPFSPGTPPVFPCPIFPITSPSCYPCPFSQVSSN
PYPQAPSSLLPLSSSASQVPLPSSSLPISAPLPFSPSYPQDPLSPTSLPVCPSPPSLPST
TAAPLLSLASAFSLAVMTVAQSLLSPSPGLLSQSPPAPPGPLPSLPLSLASCDQESLSAQ
TAETENEASRNPAQPLLGDARLAPISEEGKPQLVGRFQVTSSKEPAEPPLQPASPTLSRS
LKLPSPPLTSESSDTEDSAAGGPETREALAESDRAAEGLGVAVDDEKDEGKEPLLGGSSP
ILSHPSPVWMNYSYSSLCLSSEESESSGEDEEFWAELQNLRQKHLSEVEALQTLQKKEIE
DLYSRLGKQPPPGIVAPAAMLSCRQRRLSKGSFPTSRRNSLQRSDLPGPGIMRRNSLSGS
STGSQEQRASKGVTFAGDIGRM
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atgctagcacctcgaaatacggagactggggtccccatgtcccaaaccgaggctgacctg
gctctgcggccatctccggctctcacctctacggggccgacccgcctggggccacctcct
cgccgagtgcgccgcttctctgggaaggctgagcctcggccgcgctcttcgagacctagc
cgccgcagctcagtcgatctgggactgctgagctcctggtctcaaccagcctcactcctt
ccggaacccccggatcctccagactccgctggccccacgaggagcccaccttcaagctct
aaagaaccccccgagggcacatggatgggggcagctcccgtgaaggctgtggactctgca
tgtcctgagcttacgggatcttcaggaggtccagggtcccgggagccaccgagggttcct
gatgctgcagcccgggaacggcggcgggagcaggaagaaaaagaggacacagaaacccag
gctgtggcaacgtctccggacggccgatacctcaagtttgacattgagattggaagaggt
tccttcaagaccgtgtatcgagggctagacaccgacaccacggtagaggtggcctggtgt
gagctgcagacccggaaactctctcgggccgagcggcagcgtttctccgaggaagttgag
atgctcaaggggctgcagcaccccaacatcgtccgcttctatgactcctggaagtcggtg
ctgaggggccaggtttgcatcgtgctggtcacagaactcatgacctcgggcacgctcaag
acgtacctgaggcggttccgcgaaatgaagccccgagtccttcagcgctggagtcgccag
attctacggggacttcatttccttcattcccgagtgccccccatcctgcaccgagatctc
aagtgtgacaacgtcttcattactggcccttcaggctctgtcaaaatcggagacctcgga
ctggccacgctcaagcgcgcctcctttgccaagagcgtcattgggaccccggaattcatg
gctcctgagatgtacgaggaaaagtacgacgaggctgtggatgtgtacgcctttggcatg
tgcatgctggagatggctacgtctgagtatccctactccgagtgtcagaatgcagcacaa
atctaccgcaaggtcacttcgggcacaaagcccaacagcttctacaaggtgaagatgcca
gaggtgaaggagatcattgaaggctgcatccgcacggataagaacgagaggttcaccatc
caggatctcctggcccatgcgttcttccgcgaggaacgaggtgtgcacgtggagctggca
gaggaagatgatggagagaagccgggcctcaagctctggctgcgcatggaggatgcgcgg
cgcggggggcgtccacgagacaaccaggccatcgagttcctgtttcagctcggccgggac
gctgcggaggaggtggctcaggagatggtagccttgggcttagtctgtgaagctgactac
cagccagtggcccgtgcagttcgagaacgggttgctgctatccagcggaagcgggagaag
cttcgaaaagctagggaattggaggttctcccaccagactcaggacctcctccagcaact
gtgtctctggctccgggtccccccagtgccttccccccagagcctgaggagccagaggct
gaccagcatcaatccttcctcttccgccatgccagctactcatcaactacatctgattgc
gagactgatggctacctcagttcctccggcttcctggatgcctcagaccctgcccttcag
ccccctggggggttaccatccagccccgctgaatcccatctctgcttgccctcgggtttt
gccttgtctattccacggtctggccctggcagtgacttttctcctggggatagctacgcc
tcagatgcggcatcaggccttagtgacatgggagaaggggggcaaatgaggaaaaatcca
gtgaagactcttcgacggagacctcgatcccggctccgggtcactagtgtctcagaccag
agcgacagagttgtcgagtgtcagctgcagactcacaacagcaagatggtgacgttccga
tttgatctggatggggacagcccagaagaaattgcagctgccatggtatacaatgagttc
atcctgccctcggagcgagatggattcctgagccggatccgggagattatccagcgagtg
gagaccctgctgaagagagatgctggtcccccagaggctgctgaagatgccctgagcccc
caggaagagccagcagccctgcctgccctcccaggcccacccaatgcagagccccagaga
agcatctccccagaacagaggagctgggcagccttctccacctctccatcttctcctggc
acccccttgtcccctggggcccccttttcccctgggacccctcctgtcttcccatgcccc
atctttcctatcacttcaccctcatgctatccctgcccattctcccaggtctcttcaaac
ccctatccacaggcccccagttccctgcttcccttatcctccagtgcttctcaggttcca
cttccatcttcctctcttcccatcagcgctcccctcccattctctcctagttatccccaa
gaccctcttagccccacttctcttcccgtctgcccctctcctccctctcttccctctacc
acagcagcccctctcctctctctggctagtgccttctctctggctgtgatgactgtggcc
cagtccctgctgtccccatcccctggacttctttctcagtctcctccagcccctccaggt
cctctgcctagcctgcccctttcccttgcttcttgtgaccaggagagcctttcggcccaa
acagctgagacagagaatgaggcttcccgtaatcctgctcagccactactgggtgatgct
agactggcacctatatctgaagagggaaagccccagcttgttggccgtttccaagtgact
tcatctaaggaaccagcagagcctcccctgcaaccagcatccccaactctctccagatcc
ctaaagctgccaagccctccgctgacctcagagagctcagacacagaggacagtgctgca
ggaggcccagagactagggaggctctggcagagagtgaccgtgcagccgaaggcctgggg
gttgcggtcgatgatgaaaaggatgaagggaaggaacccctacttggaggcagttcccca
atcttgagccatcccagcccagtgtggatgaactactcctacagcagcctgtgtctgagc
agtgaggagtcggagagcagcggggaagacgaggaattctgggctgagctgcagaacctt
cggcagaagcacttgtcggaagtggaggcactacagacactacagaagaaggaaatcgag
gacttatacagccggcttgggaaacagcccccacctggtattgtagctccagctgctatg
ctgtcctgccgccagcgccgcctctcgaagggcagctttcccacctcccgccgcaacagc
ctgcagcgctctgatctccctggtcctggcatcatgcgaaggaactctctgagtggcagc
agcaccggctcccaggagcagcgggcaagcaagggggtgacattcgccggggatattggc
aggatgtga

DBGET integrated database retrieval system