KEGG   Mus musculus (mouse): 69888Help
Entry
69888             CDS       T01002                                 

Gene name
Cyp2c66, 2010301M18Rik
Definition
(RefSeq) cytochrome P450, family 2, subfamily c, polypeptide 66
  KO
K07413  cytochrome P450 family 2 subfamily C [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00140  Steroid hormone biosynthesis
mmu00590  Arachidonic acid metabolism
mmu00591  Linoleic acid metabolism
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
mmu04726  Serotonergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    69888 (Cyp2c66)
   00590 Arachidonic acid metabolism
    69888 (Cyp2c66)
   00591 Linoleic acid metabolism
    69888 (Cyp2c66)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    69888 (Cyp2c66)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    69888 (Cyp2c66)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    69888 (Cyp2c66)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    69888 (Cyp2c66)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     69888 (Cyp2c66)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   69888 (Cyp2c66)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 69888
NCBI-ProteinID: NP_001011707
MGI: 1917138
Ensembl: ENSMUSG00000067229
Vega: OTTMUSG00000028352
UniProt: Q5GLZ0
Position
19; 19 C3
AA seq 490 aa AA seqDB search
MVLGVFLGLLLTCLLLLSLWKQNSQRRNLPPGPTPLPIIGNILQLDLKDISKSLRNFSKV
YGPVFTLYLGKKPAVVLHGYKAVKEALIDHGEEFAGRGTFPVADKFIRRCGVVFSSGRTW
KEMRRFSLMTLRNFGMGKRSIEDRVQEEARCLVDELRKTKGVPCDPTFILGCAPCNVICS
IVFQNRFDYKDQEFLTFIDILNENVEILSSPWIQVCNNFPAIIDYLPGRHRKLLKNFDFA
KHYFLAKVIQHKESLDINNPRDFIDCFLIKMEQEKHNPKTEFTCENLIFTASDLFAAGTE
TTSTTLRYSLLLLLKYPEVTAKVQAEIDCVIGRHRSPCMQDRHSMPYTDAVLHEIQRYID
LLPTSLPHAVTRDVKFREYLIPKGTTVIASLTSVLYDDKEFLNPERFDPSHFLDESGKFK
KSDYFFPFSTGKRICVGEGLARTELFLFLTTILQNFNLKSPVDLKDLDTTPVANGFVSVP
PKFQICFISI
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggttctaggtgtgtttctggggcttcttctcacatgtctgcttctcctttcactatgg
aagcagaattctcagagaagaaaccttcctcctggccccacacctcttcccatcattgga
aatattcttcagctagatcttaaggacatcagcaaatctctgaggaatttttcaaaagtc
tatggccctgtgtttactctgtacttgggcaaaaagcctgctgtggtgttacatggatat
aaagctgtgaaagaagccttgattgatcatggggaggagtttgctggaagaggaaccttt
ccagtggctgacaagtttatcagaagatgtggggttgttttcagcagtgggaggacctgg
aaagagatgagacgcttctcactcatgactctgcgaaattttgggatggggaagaggagc
attgaggaccgagttcaagaggaggctcgctgtcttgtggatgaattgaggaaaaccaaa
ggtgtaccctgtgatcccaccttcattctcggctgtgctccttgcaatgtcatctgctcc
attgttttccagaatcgttttgattataaagatcaggaatttcttacctttatagacatc
ttaaatgaaaatgtagagattctgagttccccttggattcaggtttgcaataattttccc
gctatcattgattatctaccaggaagacacagaaaattacttaaaaattttgattttgca
aaacattactttttggcaaaagtaatacagcataaagagtcactggatattaacaatcct
cgggactttattgattgtttcctgatcaaaatggagcaggaaaagcacaacccaaagacg
gagtttacttgtgagaacttgatcttcacagcatctgatctgtttgctgctgggacagag
acaacaagcacaaccctgaggtactctctgctgctcctgctcaagtatccagaagtcaca
gccaaagtccaggcagagatcgactgtgtgattggcagacacaggagcccctgcatgcag
gacaggcatagcatgccctacactgatgctgtgttgcatgagatccagagatacattgat
ctccttcccaccagccttccccatgccgtgacccgtgacgtgaaattcagagagtatctc
attcccaagggcaccactgtcatagcatcactgacttctgtgctatatgatgataaagaa
ttcctcaacccagagaggtttgatcctagtcactttctggatgagagtggcaagtttaag
aaaagtgactacttttttcctttctcaacaggaaaacggatttgtgtgggagagggtctg
gctcgaacagaattatttttattcttgaccaccattttacagaactttaacttgaaatct
ccagttgatctgaaagaccttgatactactccagttgccaatggatttgtttctgtgcca
cccaagttccagatatgcttcatttccatctaa

DBGET integrated database retrieval system