KEGG   Mus musculus (mouse): 69961Help
Entry
69961             CDS       T01002                                 

Gene name
Rpp25l, 2810432D09Rik, AW987258, Rppl25
Definition
(RefSeq) ribonuclease P/MRP 25 subunit-like
  KO
K14525  
ribonucleases P/MRP protein subunit RPP25 [EC:3.1.26.5]
Organism
mmu  Mus musculus (mouse)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    69961 (Rpp25l)
   03008 Ribosome biogenesis in eukaryotes
    69961 (Rpp25l)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     69961 (Rpp25l)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     69961 (Rpp25l)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    69961 (Rpp25l)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    69961 (Rpp25l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 B1
AA seq 163 aa AA seqDB search
MEQYRRAGSVELPASSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSTRHVVFSGS
GRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPTSPDTGLDPLTVRRHVPAVWVL
LSRDPLDPSECGYQPPGAPPGLGSIPSPSCGPRPRRRARDTRS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggaacagtaccggagggccggctctgtagagcttccagcctcatcaccaatgccccag
ctacctcctgacactctggaaatgcgagtccgagatgggagcaaaatccgaaacctgcta
gggctggcgctgggtcgtttggaagggggaagcaccaggcacgtggtgttctcaggctct
ggccgggctgctggaaaggctgtcagctgtgcagagattgtcaaaaggcgggttccgggc
ctacaccagctcaccaagctccgcttcctgcaaacggaggacagctgggtcccaacttca
ccagacacgggactagaccccctcacagtccgacgccacgtgcctgcggtgtgggtactg
cttagtcgggaccccttggaccccagtgaatgtggctaccaacccccaggtgcacctcct
ggcctgggttccatacctagtcccagctgtggccccagaccccgaaggagggctcgggac
acccggtcctga

DBGET integrated database retrieval system