KEGG   Mus musculus (mouse): 70008Help
Entry
70008             CDS       T01002                                 

Gene name
Ace2, 2010305L05Rik
Definition
(RefSeq) angiotensin I converting enzyme (peptidyl-dipeptidase A) 2 (EC:3.4.17.23)
  KO
K09708  
angiotensin-converting enzyme 2 [EC:3.4.17.23]
Organism
mmu  Mus musculus (mouse)
Pathway
Renin-angiotensin system
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    70008 (Ace2)
  Digestive system
   04974 Protein digestion and absorption
    70008 (Ace2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.23  angiotensin-converting enzyme 2
     70008 (Ace2)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M2
   70008 (Ace2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   70008 (Ace2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X F5; X 76.12 cM
AA seq 805 aa AA seqDB search
MSSSSWLLLSLVAVTTAQSLTEENAKTFLNNFNQEAEDLSYQSSLASWNYNTNITEENAQ
KMSEAAAKWSAFYEEQSKTAQSFSLQEIQTPIIKRQLQALQQSGSSALSADKNKQLNTIL
NTMSTIYSTGKVCNPKNPQECLLLEPGLDEIMATSTDYNSRLWAWEGWRAEVGKQLRPLY
EEYVVLKNEMARANNYNDYGDYWRGDYEAEGADGYNYNRNQLIEDVERTFAEIKPLYEHL
HAYVRRKLMDTYPSYISPTGCLPAHLLGDMWGRFWTNLYPLTVPFAQKPNIDVTDAMMNQ
GWDAERIFQEAEKFFVSVGLPHMTQGFWANSMLTEPADGRKVVCHPTAWDLGHGDFRIKM
CTKVTMDNFLTAHHEMGHIQYDMAYARQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLPSDFQEDSETEINFLLKQALTIVGTLPFTYMLEKWRWMVFRGEIPKEQWMKKWWEM
KREIVGVVEPLPHDETYCDPASLFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKYNGSLH
KCDISNSTEAGQKLLKMLSLGNSEPWTKALENVVGARNMDVKPLLNYFQPLFDWLKEQNR
NSFVGWNTEWSPYADQSIKVRISLKSALGANAYEWTNNEMFLFRSSVAYAMRKYFSIIKN
QTVPFLEEDVRVSDLKPRVSFYFFVTSPQNVSDVIPRSEVEDAIRMSRGRINDVFGLNDN
SLEFLGIHPTLEPPYQPPVTIWLIIFGVVMALVVVGIIILIVTGIKGRKKKNETKREENP
YDSMDIGKGESNAGFQNSDDAQTSF
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgtccagctcctcctggctccttctcagccttgttgctgttactactgctcagtccctc
accgaggaaaatgccaagacatttttaaacaactttaatcaggaagctgaagacctgtct
tatcaaagttcacttgcttcttggaattataatactaacattactgaagaaaatgcccaa
aagatgagtgaggctgcagccaaatggtctgccttttatgaagaacagtctaagactgcc
caaagtttctcactacaagaaatccagactccgatcatcaagcgtcaactacaggccctt
cagcaaagtgggtcttcagcactctcagcagacaagaacaaacagttgaacacaattctg
aacaccatgagcaccatttacagtactggaaaagtttgcaacccaaagaacccacaagaa
tgcttattacttgagccaggattggatgaaataatggcgacaagcacagactacaactct
aggctctgggcatgggagggctggagggctgaggttggcaagcagctgaggccgttgtat
gaagagtatgtggtcctgaaaaacgagatggcaagagcaaacaattataacgactatggg
gattattggagaggggactatgaagcagagggagcagatggctacaactataaccgtaac
cagttgattgaagatgtagaacgtaccttcgcagagatcaagccattgtatgagcatctt
catgcctatgtgaggaggaagttgatggatacctacccttcctacatcagccccactgga
tgcctccctgcccatttgcttggtgatatgtggggtagattttggacaaatctgtaccct
ttgactgttccctttgcacagaaaccaaacatagatgttactgatgcaatgatgaatcag
ggctgggatgcagaaaggatatttcaagaggcagagaaattctttgtttctgttggcctt
cctcatatgactcaaggattctgggcaaactctatgctgactgagccagcagatggccgg
aaagttgtctgccaccccacagcttgggatctgggacacggagacttcagaatcaagatg
tgtacaaaggtcacaatggacaacttcttgacagcccatcacgagatgggacacatccaa
tatgacatggcatatgccaggcaacctttcctgctaagaaacggagccaatgaagggttc
catgaagctgttggagaaatcatgtcactttctgcagctacccccaagcatctgaaatcc
attggtcttctgccatccgattttcaagaagatagcgaaacagagataaacttcctactg
aaacaggcattgacaattgttggaacactaccgtttacttacatgttagagaagtggagg
tggatggtctttcggggtgaaattcccaaagagcagtggatgaaaaagtggtgggagatg
aagcgggagatcgttggtgtggtggagcctctgcctcatgatgaaacatactgtgaccct
gcatctctgttccatgtttctaatgattactcattcattcgatattacacaaggaccatt
taccaattccagtttcaagaagctctttgtcaagcagctaagtataatggttctctgcac
aaatgtgacatctcaaattccactgaagctgggcagaagttgctcaagatgctgagtctt
ggaaattcagagccctggaccaaagccttggaaaatgtggtaggagcaaggaatatggat
gtaaaaccactgctcaattacttccaaccgttgtttgactggctgaaagagcagaacaga
aattcttttgtggggtggaacactgaatggagcccatatgccgaccaaagcattaaagtg
aggataagcctaaaatcagctcttggagctaatgcatatgaatggaccaacaacgaaatg
ttcctgttccgatcatctgttgcatatgccatgagaaagtatttttcaataatcaaaaac
cagacagttccttttctagaggaagatgtacgagtgagtgatttgaaaccaagagtctcc
ttctacttctttgtcacctcaccccaaaatgtgtctgatgtcattcctagaagtgaagtt
gaagatgccatcaggatgtctcggggccgcatcaatgatgtctttggcctgaatgataac
agcctggagtttctggggattcacccaacacttgagccaccttaccagcctcctgtcacc
atatggctgattatttttggtgttgtgatggcactggtagtggttggcatcatcatcctg
attgtcactgggatcaaaggtcgaaagaagaaaaatgaaacaaaaagagaagagaaccct
tatgactcgatggacattggaaaaggagaaagcaatgcaggattccaaaacagtgatgat
gctcagacttccttttag

DBGET integrated database retrieval system