KEGG   Mus musculus (mouse): 70086Help
Entry
70086             CDS       T01002                                 

Gene name
Cysltr2, 2300001H05Rik, CYSLT2R, Cltr2, Cyslt2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    70086 (Cysltr2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    70086 (Cysltr2)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    70086 (Cysltr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14 D3; 14
AA seq 309 aa AA seqDB search
MEVTGTPSSYSNRNCTIENFKKEFYPIIYLIIFFWGALGNGFSIYVFLQTCKKSTSVNVF
MLNLATSDFLFISTLPFRADYYFRGSNWIFGDLACRVMSYSLYVNMYTSIYFLTVLSVVR
FLATVHPFRMFHVTSVRSAWILCGIIWVFIMASSALLLVNGQEEKDNIISCLELSPQKFK
SLLIMNHIAVAVGFLLPFLTLTVCYLLIIRILLKAEIPESGPRAAHRKALTTIVIAMITF
LLCFLPYHALRTLHLVTWDKDSCGDVLHKATVITLTMAAANSCFNPFLYYFAGENFKARL
RAIFSKVHL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaactgggacccccagcagttatagtaacaggaactgtacaatagaaaacttt
aagaaggaattttaccccatcatatacctgataatatttttctggggagccttgggaaat
ggcttttccatatatgtctttctacagacttgcaagaagtccacatctgtaaatgttttc
atgctcaacctggccacttccgattttctattcatcagcaccttgcccttcagggctgac
tattatttcagaggttccaattggatatttggggacttggcctgcagagtcatgtcttat
tccttatatgtcaacatgtatactagcatttatttcctaactgtgctgagtgtggtgcgt
ttcctggccacagtccaccccttccggatgttccatgtcaccagtgtcaggagtgcctgg
atcctctgtgggatcatatgggttttcatcatggcttcctcagccctgcttctggtgaac
ggccaagaggagaaagataacattatatcatgcttggagctgagtcctcaaaagtttaaa
agtctcctgatcatgaaccacattgcagtagcggtaggcttcttgctcccatttctcacg
ctcaccgtctgctacctgctgatcatccggatcttgttaaaggctgagattccagaatca
ggtccacgtgctgctcataggaaggcgctgaccaccattgtcattgccatgatcaccttc
ctcctctgttttctgccataccatgcactgcggaccctccacttggtcacatgggataaa
gattcatgtggggatgtgctacataaggccacagtcatcacactgaccatggctgcagcc
aatagctgcttcaatccctttctctattattttgctggggagaatttcaaagctcgatta
agggctatattcagcaaagttcatctatag

DBGET integrated database retrieval system