KEGG   Mus musculus (mouse): 70086Help
Entry
70086             CDS       T01002                                 

Gene name
Cysltr2, 2300001H05Rik, CYSLT2R, Cltr2, Cyslt2
Definition
(RefSeq) cysteinyl leukotriene receptor 2
  KO
K04323  cysteinyl leukotriene receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    70086 (Cysltr2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    70086 (Cysltr2)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    70086 (Cysltr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 TAS2R
Motif
Other DBs
NCBI-GeneID: 70086
NCBI-ProteinID: NP_001155884
MGI: 1917336
Ensembl: ENSMUSG00000033470
UniProt: Q920A1
Position
14; 14 D3
AA seq 309 aa AA seqDB search
MEVTGTPSSYSNRNCTIENFKKEFYPIIYLIIFFWGALGNGFSIYVFLQTCKKSTSVNVF
MLNLATSDFLFISTLPFRADYYFRGSNWIFGDLACRVMSYSLYVNMYTSIYFLTVLSVVR
FLATVHPFRMFHVTSVRSAWILCGIIWVFIMASSALLLVNGQEEKDNIISCLELSPQKFK
SLLIMNHIAVAVGFLLPFLTLTVCYLLIIRILLKAEIPESGPRAAHRKALTTIVIAMITF
LLCFLPYHALRTLHLVTWDKDSCGDVLHKATVITLTMAAANSCFNPFLYYFAGENFKARL
RAIFSKVHL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaactgggacccccagcagttatagtaacaggaactgtacaatagaaaacttt
aagaaggaattttaccccatcatatacctgataatatttttctggggagccttgggaaat
ggcttttccatatatgtctttctacagacttgcaagaagtccacatctgtaaatgttttc
atgctcaacctggccacttccgattttctattcatcagcaccttgcccttcagggctgac
tattatttcagaggttccaattggatatttggggacttggcctgcagagtcatgtcttat
tccttatatgtcaacatgtatactagcatttatttcctaactgtgctgagtgtggtgcgt
ttcctggccacagtccaccccttccggatgttccatgtcaccagtgtcaggagtgcctgg
atcctctgtgggatcatatgggttttcatcatggcttcctcagccctgcttctggtgaac
ggccaagaggagaaagataacattatatcatgcttggagctgagtcctcaaaagtttaaa
agtctcctgatcatgaaccacattgcagtagcggtaggcttcttgctcccatttctcacg
ctcaccgtctgctacctgctgatcatccggatcttgttaaaggctgagattccagaatca
ggtccacgtgctgctcataggaaggcgctgaccaccattgtcattgccatgatcaccttc
ctcctctgttttctgccataccatgcactgcggaccctccacttggtcacatgggataaa
gattcatgtggggatgtgctacataaggccacagtcatcacactgaccatggctgcagcc
aatagctgcttcaatccctttctctattattttgctggggagaatttcaaagctcgatta
agggctatattcagcaaagttcatctatag

DBGET integrated database retrieval system