KEGG   Mus musculus (mouse): 70261Help
Entry
70261             CDS       T01002                                 

Gene name
Chp2, 2010110P09Rik, Cbhp2
Definition
calcineurin-like EF hand protein 2
Orthology
K17611  
calcineurin B homologous protein 2
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 F3
AA seq 196 aa AA seqDB search
MGSRSSHIALIPDVEHIRRETGFSQASLLRLYHRFQALDRDEKGFLSRLDLQQIGALAVN
PLGDRIIDSFFPNGSQRLYFAGFARVLAYFRPIDEEDATLRDPKQPEPLNSRMNKLRFAF
QLYDLDRDGKISRNEMLQVLRLMVGVQVTDEQLESITDRTVQEADEDGDGAVSFLEFTKS
LEKMNIEQKMSIRILK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgggctcacgaagctctcatatcgcgctcattccagacgtggagcacattcgcagagag
acaggcttctcgcaagccagcctgctccgcctctaccaccggttccaagccctggacagg
gatgaaaagggcttcctaagccgcctagacctccagcagatcggagcactggctgtgaat
ccactgggtgaccgcattatagacagcttcttccccaacggaagtcagagactgtatttc
gcaggctttgccagggtcctggcttattttcgacctatagatgaagaagatgccacactc
cgagaccccaagcaacctgaacccctaaacagcagaatgaacaaactgcgctttgcattt
cagctctatgatctggatcgggatgggaagatctccaggaatgaaatgctacaggttctc
cgcctcatggttggggtccaggtgacggatgagcagctggagagcatcacagaccgtaca
gtgcaggaagctgatgaggacggggatggggctgtgtccttcctggagttcaccaagtcc
ttagagaagatgaacatcgaacaaaaaatgagcatccggatcctgaagtga

DBGET integrated database retrieval system