KEGG   Mus musculus (mouse): 70527Help
Entry
70527             CDS       T01002                                 

Gene name
Stambp, 5330424L14Rik, 5730422L11Rik, AW107289, Amsh, mKIAA4198
Definition
STAM binding protein (EC:3.1.2.15)
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:mmu04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
6 C3; 6
AA seq 424 aa AA seqDB search
MSDHGDVSLPPQDRVRILSQLGSAVELNEDIPPRRYYRSGVEIIRMASVYSEEGNIEHAF
ILYNKYITLFIEKLPKHRDYKSAIIPEKKDAVKKLKSVAFPKAEELKTELLRRYTKEYEQ
YKERKKKEEEELARNIAIQQELEKEKQRVAQQKQKQLEQEQFHAFEEMIQRQELEKERLK
IVQEFGKVDPGPCGPLLPDLEKPCVDVAPSSPFSPTQTPDCNTGMRPAKPPVVDRSLKPG
ALSVIENVPTIEGLRHIVVPRNLCSEFLQLASANTAKGIETCGVLCGKLMRNEFTITHVL
IPRQNGGPDYCHTENEEEIFFMQDDLGLLTLGWIHTHPTQTAFLSSVDLHTHCSYQMMLP
ESIAIVCSPKFQETGFFKLTDYGLQEISTCRQKGFHPHGRDPPLFCDCSHVTVKDRIVTI
TDLR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccatggggatgtgagcctcccaccccaagaccgggtgaggattctgtcccaa
cttgggagtgcagttgagttaaatgaagacattccaccccgtcgctactaccgctccggt
gttgagatcatccgcatggcgtccgtttactcggaagaaggcaacattgaacatgccttt
atcctctacaacaagtacatcacgctgtttattgaaaaacttccgaaacaccgagactac
aaatcagctatcattcctgagaagaaagatgctgtcaagaaattaaagagcgtcgctttc
cctaaagcggaagagctgaagacagagctcttgagaagatacaccaaagaatatgagcag
tataaagagcgaaagaaaaaggaagaagaggaacttgcccgaaatatcgccatccagcaa
gagttggaaaaagaaaaacagagggttgctcagcagaagcagaagcagctagagcaggag
caattccatgcctttgaggagatgatccagaggcaggagctggaaaaagaacggctgaaa
attgttcaagagttcgggaaggtagaccctggcccctgcgggcctctgctccctgatctg
gaaaagccttgtgtagatgtggcccccagctcaccgttctcgcccacgcagactccagac
tgtaacacaggcatgaggccagctaagccacctgtggtggacaggtccctgaaacctgga
gcgttaagcgtcatagaaaatgttcccaccattgaaggcctgcgccacatcgtggtgccc
cgtaatctgtgctcagaatttctccagcttgccagtgccaataccgccaaaggcattgaa
acctgtggagtcctctgtggaaaactgatgagaaatgaattcacaatcacacatgttctc
atccccagacaaaatggtgggcctgattattgccacacggagaatgaagaagaaattttc
tttatgcaggatgaccttggactcctcactcttggctggatccatactcatccaacccaa
acggcctttctgtccagtgtggatctccacactcactgctcctaccaaatgatgttacca
gagtccatcgcaatcgtctgttccccaaagttccaggaaactggattctttaagctaact
gactatggtcttcaagagatttcaacctgccggcagaaaggctttcacccccatggcaga
gacccaccgctgttctgtgactgcagccatgtcactgtcaaggacagaattgtgacgatc
acagaccttcgataa

DBGET integrated database retrieval system