KEGG   Mus musculus (mouse): 70527Help
Entry
70527             CDS       T01002                                 

Gene name
Stambp, 5330424L14Rik, 5730422L11Rik, AW107289, Amsh, mKIAA4198
Definition
STAM binding protein (EC:3.1.2.15)
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    70527 (Stambp)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     70527 (Stambp)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M67
   70527 (Stambp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
6 C3; 6
AA seq 424 aa AA seqDB search
MSDHGDVSLPPQDRVRILSQLGSAVELNEDIPPRRYYRSGVEIIRMASVYSEEGNIEHAF
ILYNKYITLFIEKLPKHRDYKSAIIPEKKDAVKKLKSVAFPKAEELKTELLRRYTKEYEQ
YKERKKKEEEELARNIAIQQELEKEKQRVAQQKQKQLEQEQFHAFEEMIQRQELEKERLK
IVQEFGKVDPGPCGPLLPDLEKPCVDVAPSSPFSPTQTPDCNTGMRPAKPPVVDRSLKPG
ALSVIENVPTIEGLRHIVVPRNLCSEFLQLASANTAKGIETCGVLCGKLMRNEFTITHVL
IPRQNGGPDYCHTENEEEIFFMQDDLGLLTLGWIHTHPTQTAFLSSVDLHTHCSYQMMLP
ESIAIVCSPKFQETGFFKLTDYGLQEISTCRQKGFHPHGRDPPLFCDCSHVTVKDRIVTI
TDLR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccatggggatgtgagcctcccaccccaagaccgggtgaggattctgtcccaa
cttgggagtgcagttgagttaaatgaagacattccaccccgtcgctactaccgctccggt
gttgagatcatccgcatggcgtccgtttactcggaagaaggcaacattgaacatgccttt
atcctctacaacaagtacatcacgctgtttattgaaaaacttccgaaacaccgagactac
aaatcagctatcattcctgagaagaaagatgctgtcaagaaattaaagagcgtcgctttc
cctaaagcggaagagctgaagacagagctcttgagaagatacaccaaagaatatgagcag
tataaagagcgaaagaaaaaggaagaagaggaacttgcccgaaatatcgccatccagcaa
gagttggaaaaagaaaaacagagggttgctcagcagaagcagaagcagctagagcaggag
caattccatgcctttgaggagatgatccagaggcaggagctggaaaaagaacggctgaaa
attgttcaagagttcgggaaggtagaccctggcccctgcgggcctctgctccctgatctg
gaaaagccttgtgtagatgtggcccccagctcaccgttctcgcccacgcagactccagac
tgtaacacaggcatgaggccagctaagccacctgtggtggacaggtccctgaaacctgga
gcgttaagcgtcatagaaaatgttcccaccattgaaggcctgcgccacatcgtggtgccc
cgtaatctgtgctcagaatttctccagcttgccagtgccaataccgccaaaggcattgaa
acctgtggagtcctctgtggaaaactgatgagaaatgaattcacaatcacacatgttctc
atccccagacaaaatggtgggcctgattattgccacacggagaatgaagaagaaattttc
tttatgcaggatgaccttggactcctcactcttggctggatccatactcatccaacccaa
acggcctttctgtccagtgtggatctccacactcactgctcctaccaaatgatgttacca
gagtccatcgcaatcgtctgttccccaaagttccaggaaactggattctttaagctaact
gactatggtcttcaagagatttcaacctgccggcagaaaggctttcacccccatggcaga
gacccaccgctgttctgtgactgcagccatgtcactgtcaaggacagaattgtgacgatc
acagaccttcgataa

DBGET integrated database retrieval system