KEGG   Mus musculus (mouse): 70584Help
Entry
70584             CDS       T01002                                 

Gene name
Pak4, 5730488L07Rik, AW555722, mKIAA1142
Definition
(RefSeq) p21 protein (Cdc42/Rac)-activated kinase 4 (EC:2.7.11.1)
  KO
K05734  
p21-activated kinase 4 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
MicroRNAs in cancer
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    70584 (Pak4)
   04012 ErbB signaling pathway
    70584 (Pak4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    70584 (Pak4)
  Cellular community
   04510 Focal adhesion
    70584 (Pak4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    70584 (Pak4)
  Development
   04360 Axon guidance
    70584 (Pak4)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    70584 (Pak4)
   05211 Renal cell carcinoma
    70584 (Pak4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     70584 (Pak4)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   70584 (Pak4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 A3
AA seq 593 aa AA seqDB search
MFGKKKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRESPPPPARAHQENGMLEE
RAAPARMAPDKAGSRARATGHSEAGSGSGDRRRVGPEKRPKSSRDGPGGPQEASRDKRPL
SGPDVSTPQPGSLTSGTKLAAGRPFNTYPRADTDHPPRGAQGEPHTMAPNGPSATGLAAP
QSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPARALAAPAVPPAPGPPGPRSPQREPQR
VSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQ
RRELLFNEVVIMRDYRHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIA
AVCLAVLQALAVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGT
PYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNL
HKASPSLKGFLDRLLVRDPAQRATAAELLKHPFLTKAGPPASIVPLMRQHRTR
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtttggaaagaagaagaagcgggtggagatctcagccccatccaacttcgagcaccgt
gtacacacaggctttgatcagcatgagcagaagttcacagggctgccccgccagtggcag
agcctgattgaggaatcagcacgcagacccaagcccctgatcgaccctgcctgcatcacg
tccatccagcctggagcccccaagaccatcgttcggggcagcaaaggtgccaaggatggg
gctctcactctgctgcttgacgaatttgagaacatgtcggtgacgcgctccaactcccta
cgcagagagagtccaccaccacctgcccgtgcccaccaggagaatggaatgctggaggag
cgggcagccccggccagaatggcccctgacaaagctggaagcagagcccgggccacaggc
cacagtgaggcaggcagtggcagtggtgacagacggcgggtggggccagagaaaaggccc
aaatcttcgagggatggtccaggaggaccccaggaggcctcccgcgataagcgcccactc
tctgggcctgatgtcagcactcctcagcctggcagtctgaccagcgggacaaaactagca
gctggcaggccctttaacacatacccacgggctgacacggaccacccaccccgcggtgcc
cagggggagccacataccatggcccctaatgggccttcagccacaggcctggccgctcct
cagtcttcctcctcctcccggcctcccacccgagcccgtggtgctcccagcccaggagtt
ctgggtccccatgcctctgagccccagttggcccccccagcacgtgcccttgctgcccct
gctgtacctcctgcccctgggccccctgggcctcgctcaccacagcgggagccccaacga
gtgtcccatgagcagttccgggctgccctgcagctggtggtggacccaggggaccctcgt
tcctatctagacaacttcatcaagattggtgagggctctacaggtattgtgtgcattgcc
actgtacgcagctcaggcaaactggtggccgtcaagaagatggacttgcgcaagcagcaa
agacgtgaactgctcttcaatgaggtggtgatcatgcgggactaccggcacgagaacgtg
gtggagatgtacaacagctacctggtgggtgacgaactctgggtcgtcatggagttcctg
gaaggcggcgccctcacggatattgtcacccacaccaggatgaacgaggaacagatcgcc
gccgtgtgcctggctgtgcttcaggcgctggctgtgctccacgcccagggtgtcatccac
cgtgacatcaagagtgactctatcttgctgacccatgatggccgggtgaagctgtccgac
ttcgggttttgtgcccaggtgagcaaggaggtgcctcggaggaagtcgctggtgggcacc
ccgtattggatggccccggagctcatctcccgccttccctatgggccagaggtggatatc
tggtcactgggggtgatggtgatcgagatggtggatggggagcccccttacttcaacgag
ccacccctcaaagctatgaagatgatccgggacaacctcccgccccgactgaagaacctg
cacaaggcgtcaccgtctctgaaaggcttcttggatcgcctgctagtgcgggacccggcc
cagcgggccactgctgccgagctgctgaagcacccgttcctcaccaaggcggggccacca
gccagcatcgtgcccctgatgcgccagcaccgaaccagatga

DBGET integrated database retrieval system