KEGG   Mus musculus (mouse): 70584Help
Entry
70584             CDS       T01002                                 

Gene name
Pak4, 5730488L07Rik, AW555722, mKIAA1142
Definition
(RefSeq) p21 protein (Cdc42/Rac)-activated kinase 4
  KO
K05734  
p21-activated kinase 4 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
MicroRNAs in cancer
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    70584 (Pak4)
   04012 ErbB signaling pathway
    70584 (Pak4)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    70584 (Pak4)
  Cell motility
   04810 Regulation of actin cytoskeleton
    70584 (Pak4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    70584 (Pak4)
  Development
   04360 Axon guidance
    70584 (Pak4)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    70584 (Pak4)
   05211 Renal cell carcinoma
    70584 (Pak4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     70584 (Pak4)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   70584 (Pak4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 B1
AA seq 593 aa AA seqDB search
MFGKKKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRESPPPPARAHQENGMLEE
RAAPARMAPDKAGSRARATGHSEAGSGSGDRRRVGPEKRPKSSRDGPGGPQEASRDKRPL
SGPDVSTPQPGSLTSGTKLAAGRPFNTYPRADTDHPPRGAQGEPHTMAPNGPSATGLAAP
QSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPARALAAPAVPPAPGPPGPRSPQREPQR
VSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQ
RRELLFNEVVIMRDYRHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIA
AVCLAVLQALAVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGT
PYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNL
HKASPSLKGFLDRLLVRDPAQRATAAELLKHPFLTKAGPPASIVPLMRQHRTR
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtttggaaagaagaagaagcgggtggagatctcagccccatccaacttcgagcaccgt
gtacacacaggctttgatcagcatgagcagaagttcacagggctgccccgccagtggcag
agcctgattgaggaatcagcacgcagacccaagcccctgatcgaccctgcctgcatcacg
tccatccagcctggagcccccaagaccatcgttcggggcagcaaaggtgccaaggatggg
gctctcactctgctgcttgacgaatttgagaacatgtcggtgacgcgctccaactcccta
cgcagagagagtccaccaccacctgcccgtgcccaccaggagaatggaatgctggaggag
cgggcagccccggccagaatggcccctgacaaagctggaagcagagcccgggccacaggc
cacagtgaggcaggcagtggcagtggtgacagacggcgggtggggccagagaaaaggccc
aaatcttcgagggatggtccaggaggaccccaggaggcctcccgcgataagcgcccactc
tctgggcctgatgtcagcactcctcagcctggcagtctgaccagcgggacaaaactagca
gctggcaggccctttaacacatacccacgggctgacacggaccacccaccccgcggtgcc
cagggggagccacataccatggcccctaatgggccttcagccacaggcctggccgctcct
cagtcttcctcctcctcccggcctcccacccgagcccgtggtgctcccagcccaggagtt
ctgggtccccatgcctctgagccccagttggcccccccagcacgtgcccttgctgcccct
gctgtacctcctgcccctgggccccctgggcctcgctcaccacagcgggagccccaacga
gtgtcccatgagcagttccgggctgccctgcagctggtggtggacccaggggaccctcgt
tcctatctagacaacttcatcaagattggtgagggctctacaggtattgtgtgcattgcc
actgtacgcagctcaggcaaactggtggccgtcaagaagatggacttgcgcaagcagcaa
agacgtgaactgctcttcaatgaggtggtgatcatgcgggactaccggcacgagaacgtg
gtggagatgtacaacagctacctggtgggtgacgaactctgggtcgtcatggagttcctg
gaaggcggcgccctcacggatattgtcacccacaccaggatgaacgaggaacagatcgcc
gccgtgtgcctggctgtgcttcaggcgctggctgtgctccacgcccagggtgtcatccac
cgtgacatcaagagtgactctatcttgctgacccatgatggccgggtgaagctgtccgac
ttcgggttttgtgcccaggtgagcaaggaggtgcctcggaggaagtcgctggtgggcacc
ccgtattggatggccccggagctcatctcccgccttccctatgggccagaggtggatatc
tggtcactgggggtgatggtgatcgagatggtggatggggagcccccttacttcaacgag
ccacccctcaaagctatgaagatgatccgggacaacctcccgccccgactgaagaacctg
cacaaggcgtcaccgtctctgaaaggcttcttggatcgcctgctagtgcgggacccggcc
cagcgggccactgctgccgagctgctgaagcacccgttcctcaccaaggcggggccacca
gccagcatcgtgcccctgatgcgccagcaccgaaccagatga

DBGET integrated database retrieval system