KEGG   Mus musculus (mouse): 70661Help
Entry
70661             CDS       T01002                                 

Gene name
Sik3, 5730525O22Rik, 9030204A07Rik, AI447252, AI846254, AI849445, Qsk, SIK-3, mKIAA0999
Definition
(RefSeq) SIK family kinase 3 (EC:2.7.11.1)
  KO
K19009  
serine/threonine-protein kinase SIK3 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     70661 (Sik3)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   70661 (Sik3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 A5.2
AA seq 1369 aa AA seqDB search
MAAAAASGAGGVAVAGAGGAGPAGRLLPPPAAGPPAAPAAVPPAAVPARPTAPASRGSMA
ARIGYYEIDRTIGKGNFAVVKRATHLVTKAKVAIKIIDKSQLDEENLKKIFREVQIMKML
CHPHIIRLYQVMETERMIYLVTEYASGGEIFDHLVAHGRMAEKEARRKFKQIVTAVYFCH
CRNIVHRDLKAENLLLDANLNIKIADFGFSNLFTPGQLLKTWCGSPPYAAPELFEGKEYD
GPKVDIWSLGVVLYVLVCGALPFDGSTLQNLRARVLSGKFRIPFFMSTECEHLIRHMLVL
DPNKRLSMEQICRHKWMKLGDADPNFDRLIAECQQLKEERQSDPLNDDVLLAMEDMGLDK
ERTLQSLRSDAYDHYSAIYSLLCDRHKKHKTLRPGALPSMPQAMTFQAPVNLQAEQTGTA
MNLSVPQVQLINPENQIIEPDGAVNLDSDEGEEPSPEALVRYLSMRRHTVGVADPRTEVM
EDLQKLLPGFPGVNPQGPFLQVAPNMNFTHNLLPMQSLQPTGQLEYKEQSLLQPPTLQLL
NGMGPLGRRASDGGANIQLHAQQLLKRPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEA
VQRYLANRSKRHTLAMTSPTAEIPPDLQRQLGQQSFRSRVWPPHLVPDQHRSTYKDSNTL
HLPTERFSPVRRFSDGAASIQAFKAHLEKMGNSSSIKQLQQECEQLQKMYGGQVDERTLE
KTQQQHMLYQQEQHHQILQQQIQDSICPPQPSPPLQVACENQPALLTHQLQRLRIQPSSP
PPNHPSNHLFRQPSNSPPPVSSAMITSHGATSPSQFQGLPSHGAIFQQQPENCSPPPSVA
LTCLGLQQASQSQPVTIQLQEPVDMLSNMAGTAAGSAGRSIPISPSASQIQIQHRASLMA
PFSYGHRPLSKQLSADSAEAHSLNMNRFSPANYDQAHLHPHLFSDQSRGSPSSYSPSTGV
GFPPTQALKVPPLDQFPTFPPSAQQQPPHYTTSALQQALLSPTPPDYPRHQQVPHILQGL
LSPRHSLTGHSDIRLPPAEFAQLIKRQQQHRQQQQQQQQQQEYHELFRHMNQGDAVSLAP
SLGGQNMTEQQALSYQNADSYHRHHTSPQHILQIRAQDCISQGPSPTPTHGYAHQPPLMH
SESMEEDCLCEGLKEGFPDKSSSTLTKGCHNSPLLLCTSGPGDPEPLLGTVSQARELGIH
PYGHQPTATTFSRNKVPSRESVLGNCLERSSPGQAMELPDHNGLGYPVRPLVSEHLRSRT
LQRHHTIQNSDDAYVQLDTLPGMSLVAGKALSSARMSDAVLSQSSLMGSQQFQDEEDEEC
GVSLGHEHPGLGDGSQHLNSSRYPATCVTDIMLSHKHPEVSFSMEQAGV
NT seq 4110 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcgagcggagctggcggggttgccgtggccggagcagggggagcc
gggccggccggccgcctgctgcctccgcccgccgcggggcccccggcagcccccgccgca
gtgcccccggccgccgtcccggcgcgtcccacagccccggcctcccgcgggtcgatggcc
gctcgcatcggctactacgagatcgaccgcaccatcggcaagggcaacttcgctgtggtc
aagcgggccacgcacctcgtcaccaaggccaaggttgctattaaaatcatagataagagc
cagctggatgaagaaaacttgaagaagattttccgggaggttcagataatgaagatgctt
tgccatccacacatcatcagactctaccaggtcatggagacagagcgcatgatttacctg
gtgacagaatacgctagcggaggggagatatttgaccacttggtagcccatggaagaatg
gcagagaaggaagctcgacggaagttcaaacagatcgtcacagcggtgtatttttgtcac
tgtcggaatatcgttcatcgtgatttaaaagccgaaaacttacttctggacgccaatctg
aatatcaaaatagcagactttggcttcagcaacctcttcactccagggcagctgctgaag
acgtggtgtggcagccctccctatgccgccccagagctcttcgaagggaaggaatatgat
gggcccaaagtggacatatggagccttggagttgtcctctatgtgctggtgtgtggcgcc
ctgccgtttgatgggagcacactgcagaatctgcgggcccgcgtgctgagtggcaagttc
cgcatcccgttctttatgtccacagagtgtgagcacttgatccgccacatgctggtgtta
gatccaaataagcgcctctcaatggaacagatctgcaggcacaagtggatgaagctcgga
gatgcagaccccaactttgacaggttaatagcggagtgccagcaactgaaggaggaaagg
cagtcggaccccctcaacgatgatgtcctcttggctatggaagacatggggctggacaag
gagcgcacacttcagtcattaaggtcagatgcctatgaccactatagtgcaatctacagc
ctgctgtgcgatcgacacaagaaacataaaactctgcgtcccggagcacttcccagcatg
ccccaagccatgactttccaggcaccagtcaatctccaggcggagcagacaggcactgct
atgaaccttagcgtccctcaagttcagctgatcaacccagagaaccaaattatagagcct
gacggggctgtgaacttggacagtgatgagggtgaagagccttctccagaagccttggtt
cgctatttgtcaatgaggaggcacacggtgggagtggctgacccacgcacggaagttatg
gaagatctgcagaagctgctgcctggctttcctggagtaaacccacagggtccattccta
caagtggcccctaacatgaacttcacgcacaacctgttgcccatgcagagtctgcagcca
actgggcagcttgagtacaaggaacagtctctgttacagccgcctacactacagctactg
aacggaatggggccccttggccggagagcctcagatggaggcgccaacatccaactgcat
gcccagcagctgctcaagcgcccacggggaccgtccccacttgtcaccatgacaccagca
gtgccagcagttacccctgtggatgaggagagctcggatggggagccagatcaggaagct
gtgcagaggtacttggcaaataggtccaaaaggcacacactggccatgaccagcccgaca
gctgagatcccaccggacctgcaacggcagctaggacaacagtctttccgttcccgggtc
tggcctcctcacctggtacctgaccagcatcgctccacctacaaggactccaacaccctg
catctccctacggagcgtttctcccccgtgcgccggttctcagacggggctgcaagcatc
caggccttcaaagctcacctggaaaaaatgggcaacagcagcagcatcaagcagttgcag
caggagtgtgagcagctgcagaagatgtacggggggcaggtggatgagaggaccctggag
aagacccagcagcagcatatgttgtaccagcaggagcagcaccatcagatcctccagcag
caaatccaagattctatttgtcctcctcagccctccccacctcttcaggttgcctgtgaa
aaccaaccagccctcctcacccaccagctccagaggttaaggattcaaccttcaagccca
ccccccaaccatcccagcaaccatctcttcagacagccaagtaacagtcctcccccggtc
agcagtgccatgatcacgtctcacggtgctacgtctccctcccagtttcaaggcttaccc
tcccatggtgcaatcttccagcagcaacccgagaactgttccccgcctcccagtgtagca
ctaacctgcctgggcctacagcaggctagccagtcacagccagtgactatccagctacag
gagccagttgacatgctcagcaacatggccggaaccgcggcaggctctgcagggcggagc
atccccatcagccccagcgccagtcagattcagatacagcaccgagccagcctaatggct
cccttcagctatgggcaccggcccttgtccaagcagctgagcgctgacagtgcagaggcc
cacagcttgaacatgaatcggttctcccctgccaactacgaccaggcgcatttacacccc
catctgttttcggaccagtcccgaggttcccccagcagctacagcccttcaacaggagtg
gggtttcctccaactcaagccctgaaagttcctccgcttgaccagttccccactttccct
cccagtgcccagcagcagccaccccactataccacgtcagcactacagcaggccctgcta
tctcctacaccgccagactatccccgacaccagcaggttccccatatccttcaaggactg
ctctctccccggcattcactcaccggccactcggacattcggctgcctccggcagagttt
gcacagctcatcaaaaggcagcaacagcatcgacagcagcagcagcagcagcagcagcaa
caagaataccatgaattgttcaggcacatgaaccaaggggatgctgttagcctagctccc
agcctcgggggacagaatatgacagagcaacaggctttatcttatcaaaatgctgactcg
taccaccgccaccacaccagcccccagcatatcttacagatcagggcgcaagattgtatc
tcacagggtccctcgcccacccccacccatggctatgcccatcagccaccactaatgcat
tcggagagtatggaggaagactgcttgtgtgaggggctcaaggagggcttcccagacaag
agctcaagcacactgaccaaaggttgccacaacagccctctgctcttgtgtaccagtggg
cctggggaccctgagcctttgctgggaactgtgagtcaggcccgggagctggggatccat
ccctacggacaccagccaactgccaccacgttcagtagaaataaggtgcccagccgagag
tctgtcctagggaactgcctggaaagaagttctcctggacaagcaatggagctgccggat
cacaacggccttgggtacccagtacggcccttagtcagtgagcacctcaggtcccggacg
ctccagagacaccacacgatccagaacagcgacgatgcctatgtacagctggataccttg
ccaggaatgagcctggtggcaggcaaggcgctgagctctgcccggatgtcagatgcagtt
cttagtcagtcttcactcatgggcagccaacagtttcaggatgaggaagatgaagaatgt
ggggtgagcctgggccacgagcatccaggcctgggtgatggcagccagcatctcaactcc
tctcgctatccagctacgtgtgttacagacatcatgctcagccacaagcacccagaggtc
tccttcagcatggagcaagccggcgtgtag

DBGET integrated database retrieval system